KEGG   Melittangium boletus: MEBOL_007966Help
Entry
MEBOL_007966      CDS       T05066                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mbd  Melittangium boletus
Pathway
mbd00620  Pyruvate metabolism
mbd00680  Methane metabolism
mbd01100  Metabolic pathways
mbd01120  Microbial metabolism in diverse environments
mbd01200  Carbon metabolism
Module
mbd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MEBOL_007966
  09102 Energy metabolism
   00680 Methane metabolism
    MEBOL_007966
Enzymes [BR:mbd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MEBOL_007966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATB34463
UniProt: A0A250IT72
LinkDB All DBs
Position
complement(9752078..9754747)
Genome map
AA seq 889 aa AA seqDB search
MPPIRHVDLPLRQDVRLLGQLLGEVIIEQEGQAVFELEERVRRLSIERRRGPKSGRRAAA
SELAALLRRMPLEQAEPVLRAFSTYFRLVNLAEQNHRVRRTREHQISGQRGAQRGSLEAV
MQQLRQAGVSAAKLRETLQAMRVTLTLTAHPTQAARRTVLEKTYRLARLLENRDRCQLTP
REKADTHLAMREEISALWQTDELRRERPTVGDEVKNVLWYVEEVLAEQLALMPETLNWAF
ERAYGEPLGVIVAPVRVHSWVGGDMDGNPLVTPEVFADTLRAHRARGLRALRENIAKLGW
VLTQSERHTHVSDELQASLDADARALPEVMARYGARTEGEPWRRKLRFMEGRLQAALVYV
EGRRAGKTNPLPDAAYRSPQDLLRDLELLERSLNEARAGHAGVRQIRRFIALVRAVGFHL
AELEVRAPAEDARSAAASLNGGPAPTEGGKRLLAVLQRMREAQAESGEGCCRTLILSMAS
TAEDVLAAFQCAKGVGLWDEARGCATVDVVPLFEQLGALDDGPGVLRALFTHAEYRQHLK
ARGVQEVMVGYSDSGKEVGLLAANAALYRAQSALTQVAHEAGVRLRLFHGRGETVARGGG
PAQAAILALPPGSVAGTYKATEQGEALDHKYARPELARRTLELVLGGVLLHSLDAQPRLA
SEEEPAFRAAFDELAETGRRAYRALVWEDPAFVPFFQAATPIEEISALPIGSRPSKRAAG
GLESLRAIPWVFSWTQNRAILPGWYGVGSALETLGSRPEGLVLLNRMYKQWPYFRTVIDN
VAMVLAKSDMAIASRYAALAPESTKDLWARIRAEYSRTLRWVKRVTGEPRLLANNRQLKQ
SIALRNPYIDPMSFLQVELMRRKRAGEDHCDRPLLLTLSGIAGGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccattcgtcacgtggatctgccgctgcgccaggacgtccggctcctgggccaa
ctgctcggggaagtcatcatcgaacaggagggtcaggccgtcttcgagctggaggagcgc
gtgcgccggctctccatcgagcggcgccggggtcccaagtcaggccgccgcgccgccgcc
tcggagctggccgcgctcctgcgccgcatgcccctggagcaggccgagcccgtgctgcgc
gccttctccacctacttccgcctcgtcaacctggccgagcagaaccaccgcgtgcgccgc
acccgcgagcatcagatcagcggacagcgcggggcccagcgcggctcgctcgaggcggtg
atgcaacagctgcggcaggcgggcgtgagcgccgcgaagctgcgcgagacgctccaggcc
atgcgcgtgacgctcaccctcaccgcgcaccccacccaggccgcgcgccgcaccgtgctg
gagaagacgtaccggctcgcccggctcctggagaaccgcgaccgctgccagctcacgccc
cgcgagaaggcggacacgcacctggccatgcgcgaggagatctccgccctgtggcagacg
gacgagctgcgccgcgagcgccccacggtgggcgacgaggtgaagaacgtcctctggtac
gtggaggaggtgctggccgagcagctcgcgctcatgccggagacgctcaactgggccttc
gagcgcgcctatggcgagcccctgggcgtcatcgtcgcgccggtgcgggtgcactcgtgg
gtgggcggcgacatggacggcaatcccctggtgacgcccgaggtgttcgcggacacgctg
cgcgcccaccgggcccggggcctgcgcgccctgcgcgagaacatcgccaagctggggtgg
gtgctcacccagtccgagcgccatacccacgtctccgatgaactccaggcctcgcttgac
gcggatgcccgcgccctgcccgaggtgatggcgcgctatggtgcccgtaccgagggcgag
ccctggcgccgcaagctgcgcttcatggagggacggctccaggccgcgctcgtctacgtc
gagggccgccgcgccgggaagacgaatccgctacccgacgccgcctaccgctcgccccag
gatctcctgagggatctggagctgctggagcgctcgctcaacgaggcccgggcgggtcac
gcgggcgtgcggcagatccgccgcttcatcgcgctggtgcgcgccgtgggcttccacctc
gccgagctggaggtgcgcgcccccgccgaggacgcgcgcagcgccgccgcgtccctgaat
ggcggccccgcgccgaccgagggcggcaagcggctgctcgcggtgctccagcgcatgcgc
gaggcccaggccgagtcgggggaggggtgttgccgcacgctcatcctctccatggcctcg
accgccgaggacgtgctggcggccttccagtgcgccaagggcgtggggctctgggacgag
gctcgcgggtgcgccaccgtggacgtggtgcccttgttcgaacaactcggggcgctcgat
gacggcccgggcgtgctgcgcgcgctgttcacccacgcggagtaccgccagcacctcaag
gcgcgcggggtgcaggaggtgatggtgggctacagcgactcgggcaaggaggtggggctg
ctggccgccaacgccgcgctctaccgggcccagtccgcgctcacccaggtggcgcacgag
gcgggggtgcgcctgcgcctgttccacggccgtggcgagacggtggcgcgtggcggcggt
cccgcccaggcggccatcctcgcgttgccgccgggcagcgtggcgggcacctacaaggcc
accgagcaaggcgaggcgttggatcacaagtacgcccgtcccgagctggcgcggcgcacc
ctggagctggtgctcggcggggtattgctgcactcgctcgatgcccagccgcggctggcg
tccgaggaggagcccgcgttccgtgccgccttcgacgagctggcggagacgggccgccgc
gcctaccgggcgctcgtctgggaggatccagccttcgtgcccttcttccaggcggccacg
cccatcgaggagatctccgccctgcccatcggctcgcgcccgagcaagcgtgccgcgggc
ggcctcgagtccctgcgcgccatcccctgggtgttctcctggacgcagaatcgcgcgatc
ctcccgggttggtacggggtgggctcggcgctggagacgctgggctcgcggcccgagggg
ctggtgctgctcaaccgcatgtacaagcagtggccctacttccgcaccgtcatcgacaac
gtggccatggtgctcgccaagtcggacatggccatcgcctcgcgctacgcggccctggcc
cccgagtccacgaaggacctgtgggcgcgcatccgcgccgagtactcgcgcaccctgcgg
tgggtgaagcgcgtgacgggagagccgcgcctgctcgccaacaaccggcagctcaagcag
agcatcgccctgcgcaacccctacatcgatcccatgtccttcctccaggtggagctcatg
cggcgcaagcgcgcgggagaggaccactgcgaccggccgctgctgctcacgctcagcggc
atcgccgggggcatgcgcaacaccgggtga

DBGET integrated database retrieval system