KEGG   Marssonina brunnea: MBM_00950Help
Entry
MBM_00950         CDS       T03105                                 

Definition
(RefSeq) histone H3 lysine 36 (K36) methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mbe  Marssonina brunnea
Pathway
mbe00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mbe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MBM_00950
Enzymes [BR:mbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MBM_00950
Chromosome and associated proteins [BR:mbe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MBM_00950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26 CENP-O
Motif
Other DBs
NCBI-GeneID: 18756885
NCBI-ProteinID: XP_007288839
UniProt: K1XHN1
LinkDB All DBs
Position
Unknown
AA seq 1038 aa AA seqDB search
MADDTREPNPEAVDAALEEMKLDEVAPAAEQDSTQANGKVGKEARPSYLTRSRSSTPAVK
HSASQSPLEKQSASQTPKSEDEEVEEEIIGGGITVTVEPGKAPKLLRKSLQKITARPPPL
FNDVPDATEEATGVFQKIKDCIYGSKGMGSSEHDALDCDCSEEWRDGKNHACGEDSDCIN
RATKMECVGGECNCGSGCQNQRFQQKQYADVSVFKTEKKGYGLRANVDLDANDFIFEYIG
EVINEPTFRRRTVQYDQEGIKHFYFMSLTKHEFVDATKKGNLGRFCNHSCNPNCYVDKWV
VGEKLRMGIFAERNIKAGEELVFNYNVDRYGADPQPCYCGEANCTGYIGGKTQTERATKL
SHATIEALGIDDGDGWDSAVAKKPRKKKTGEDDEEYVNNVQPKGLDEEGVRKVMAALMQC
KEKWIAVKLLGRIQRCDDDRVRNRVVQMHGYQILRSTLNMWKEDNNVILQVLDILYKFPR
LTLNKIEDSKIESTIIELSTSEHEDVASESARLLAEWKKLDRGYRIPRKKFDPSAVPVFE
RRNTDRPDEVSRSPATPIVTAPAGPRSNIPQRTFGFAPSRPPPIRRPLNALPAGWFAAQD
AKGNTYYYSKSGATTWVKPYLPAPEPPPPPKAPPKSVQTAKALQDIIDSITKPDPKTPVQ
STPTGTSTPKDAKKPAEKWRSLTVEKQMKLYENTLLPHIRHVMQKFTKQLPKEDLKKFAR
EVGKKLVASDYKNNRVSDPTKISEKQEKKVKSYVRDFFERAVEKKKALDKRKAEKHSSSS
FLGSVDHGVNEKESGNGEVKVEDDGEEIGLTPSPVEPEPEPEPDTPSLTGSGSTSDLKRK
RTEDELGTPGGDEDSSISFANLISDSHKRLKEEDGVGVVGLGLLLDGTPPPPPPPPPADD
IPMADGDQVMGDVDASADAEEEEESEEAKELRRQEEDLMRENEEAMASALIEHGGAETTD
RNTHDDDDNGVGGEQEGVNRNRHGIGIGIGIGNRHGHTPKATTPDLDVDAMEGVEADVVV
HAGRQVGHGEQATGSLDR
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgatactcgggagccgaatccagaagcagtcgatgctgcgctggaagagatg
aagctcgacgaagttgcgccagcagcagagcaggatagtacccaggccaatggcaaggtg
ggaaaagaggcaagacccagctatttgacgcggtcccgatcttcaactcctgcggtcaag
cactcggcgtctcagtcaccattggagaagcagagcgcgagccagacccccaagtctgaa
gatgaggaggtagaagaggagataattgggggcggcatcacagttacagttgagcccggc
aaggcacccaagttgctacgaaaatcattacagaaaataactgctcgtccaccaccacta
ttcaacgatgtgccagatgctacggaggaggctacgggggtatttcagaagatcaaggac
tgcatctacggctccaagggaatgggatcttctgagcacgatgccttggattgcgattgc
tctgaagagtggagggatggcaaaaaccatgcatgtggcgaagattccgactgtatcaac
cgtgcgacgaaaatggagtgtgtcggcggagaatgcaattgtggctccgggtgccagaac
cagcgatttcaacaaaagcaatacgccgacgtctcggtcttcaagactgaaaagaagggc
tacggcctgcgcgccaatgtcgacctcgatgcgaacgacttcattttcgagtatataggc
gaagtcatcaacgagccgacgtttcggaggcggacggtgcagtatgatcaagaaggtatc
aagcatttctatttcatgtctctcacgaagcacgagttcgtcgatgcgacgaagaagggt
aatctcggtcgattctgcaatcattcctgcaaccccaactgctacgtggacaaatgggtg
gttggggagaagttgcgcatgggcatttttgccgagcgaaatatcaaagctggcgaggag
ctagtcttcaactacaatgtggaccgatacggcgccgacccgcagccctgttactgtggc
gaagccaactgcactggttacattggaggtaagacgcagactgagcgcgcaaccaaacta
tcgcatgcaacgattgaggcgctcggtatcgacgacggcgatggatgggattcggcggtc
gcgaagaagcctcggaagaaaaagaccggcgaagacgacgaggaatacgtcaacaatgtt
caacccaagggtcttgacgaggaaggcgtccggaaggtcatggccgccctcatgcaatgc
aaggaaaaatggattgcagtcaaattactcggtcgtattcagcgatgcgacgacgatcga
gttcggaaccgggttgttcagatgcacggttaccagatcctccgcagcaccctgaacatg
tggaaggaagacaacaatgtcatcctccaagttctcgatatcctctacaaattcccccga
cttacgctgaacaagattgaagactctaaaatcgaatctacgattatcgagctctcaaca
tccgaacacgaagatgtcgcatccgagtctgcgcgcctcttggctgagtggaagaaactc
gaccgtggctaccgcatcccccgcaaaaagttcgatccgtcagccgtcccggtcttcgaa
cgtcgcaacaccgaccgcccagatgaagtctctagatcccctgcgactccaatcgtcacc
gcacccgcaggacctcgcagtaacattccacaacgaacctttggcttcgctccctcccga
cctccgccaatccgcagacccttgaacgcattgcctgctgggtggttcgccgcccaggat
gcaaagggcaacacatactactacagcaaatccggcgcaaccacctgggtaaaaccctat
cttccagctcctgaaccacctccacctccgaaagcgcctccgaagagcgtccagaccgca
aaggctctccaggacatcatcgacagcatcacaaaaccggaccccaaaacccctgttcaa
tctacaccaaccggcacctcgacgccgaaagacgccaagaagccagctgagaaatggcgg
tcgcttactgtggagaagcagatgaagctgtacgagaatactctcctccctcacatccgc
cacgtaatgcaaaagttcaccaagcaactgcccaaagaagacctgaagaaatttgccaga
gaagtcggcaagaaactcgtcgcctccgactacaaaaacaaccgcgtctcggaccctacc
aagatctctgagaagcaagagaagaaagtcaagtcctacgtgcgtgacttcttcgagcgg
gctgtggagaagaagaaggcgctagacaagcggaaggccgagaaacattcttcttcgagc
ttcctcggttctgtggatcacggggtgaacgagaaagagagtgggaatggggaagtcaaa
gtcgaagacgacggcgaggaaattggcctcacaccctccccggtcgagcccgaacccgaa
cccgaacccgacaccccatccctcaccggctccggctcaacgtccgatctgaagcggaaa
cgcactgaggacgagctcggcacgcccggcggcgacgaggactccagcatctcgttcgcg
aacctgatctcggactcccacaagcggttgaaggaggaggatggtgtgggtgttgttggg
ctgggacttcttctcgacggcacacctccgccgccgccgccgccgccacccgccgacgat
attccaatggcggatggcgatcaggtcatgggcgatgtcgatgctagtgccgatgctgag
gaggaggaggagagcgaggaggcgaaggagttgcggcggcaagaggaagatctcatgcgc
gagaatgaagaggctatggctagcgcgctgatcgagcacggcggcgcggagaccacggat
cggaacactcacgacgacgatgataatggtgttggtggggaacaagaaggcgtcaatagg
aatcggcacgggattgggattgggattgggattgggaatcggcatgggcacacgcctaaa
gcgacgactcctgatctagatgtcgacgcgatggagggcgtcgaggcggatgtggttgtt
cacgccggccggcaggttgggcatggagagcaggctacagggtcgctcgatcggtga

DBGET integrated database retrieval system