KEGG   Marssonina brunnea: MBM_01166Help
Entry
MBM_01166         CDS       T03105                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mbe  Marssonina brunnea
Pathway
mbe00250  Alanine, aspartate and glutamate metabolism
mbe00410  beta-Alanine metabolism
mbe00430  Taurine and hypotaurine metabolism
mbe00650  Butanoate metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
Module
mbe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MBM_01166
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MBM_01166
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MBM_01166
   00430 Taurine and hypotaurine metabolism
    MBM_01166
Enzymes [BR:mbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MBM_01166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 18757101
NCBI-ProteinID: XP_007289055
UniProt: K1Y5K5
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MVHLASIKHDGLVDQPLVKGLEKLGIAAGSDEDSFATTVYGSRFAAEDMPKHEMPEKEMP
KEVAYRMIKDDLSLDGNPMLNLASFVTTFMEKEVEDLMTESFSKNFIDYEEYPQSADIQN
RCVSMIGRLFNAPTASETDAPVGTSTVGSSEAIMLGVLAMKKRWQNARKAAGKPWDKPNI
VMSSAVQVCWEKAARYFEVEEKYVYCTQDRYVIDPEETVNLVDENTIGICVILGTTYTGE
YEDAKKVNDLLIERNIDTVIHIDAASGGFVAPFVVPELEWDFRLEKVVSINTSGHKYGLV
YPGVGWVIWRAPEYLPKELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLGKRGYR
SIMSNLTRTADYLSDSLSQLGFIIMSQKNGQGLPLVAFRLDPKAGKHYDEFALAHQLRGR
SWVVPAYTMAPNTKDLKMLRVVVREDFSKSRCDQLLADIKLCIGVLDDMDKNEVVRSEKY
IKEHQSHSGRSGHNHEAYRKEKHSLQGKTGKTHAIC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtccacctcgccagcatcaagcacgacggcctcgtcgaccaacccctcgtcaagggt
ctcgagaaactcggcattgccgccggcagcgatgaagactccttcgccactaccgtctat
ggctcgcggttcgccgcggaggatatgccaaagcatgagatgcctgagaaggagatgccg
aaggaggttgcctaccgtatgatcaaggatgatctgagcttggatggcaaccccatgctg
aacttggcttcgttcgtcactacgttcatggaaaaagaagtcgaagacctaatgaccgaa
tcgttctccaagaacttcatcgactacgaagaatacccccaatcagccgacatccaaaac
cgttgcgtctccatgatcggccgtcttttcaacgccccgactgcctccgaaaccgatgct
cccgtcggcacatcgaccgtcggctcctccgaagctatcatgctcggagttctcgccatg
aagaagcggtggcagaacgctcgcaaggctgctggcaagccgtgggataaacctaacatc
gtgatgagctctgctgtgcaggtgtgctgggagaaggctgcgcggtactttgaggtcgag
gagaagtacgtgtactgtacgcaggaccggtatgtgattgatcccgaagagacggtcaat
ctggtggacgagaatacgattggtatctgtgttattttgggcacgacatatacgggcgag
tatgaggatgcgaagaaggtcaacgacttgctgatcgagcggaacattgatacggttatc
catattgatgctgcatctggaggatttgtggcgccgtttgtggtgcccgagttggagtgg
gatttcaggcttgagaaagttgtgtcgattaatacttcgggtcacaaatatggccttgtc
tatccaggtgttggatgggtcatctggcgtgcgcccgaatatctccctaaggagctcgtc
ttcaacatcaattaccttggtgcagatcaagcctcgttcaccctgaacttttcgaaaggt
gcctcccaagtaatcggccaatactaccagctgatccgcctcggcaagcgtggctaccgc
tccatcatgtccaatctgacccgcactgccgactacctctccgacagcctctcccaacta
ggtttcatcatcatgtcccaaaagaacggccaaggtctccccctcgtcgccttccgtctc
gaccccaaagcaggtaagcactacgacgagttcgctctcgctcaccaactacgtggccgc
tcctgggtcgtcccggcttacaccatggcgcccaacaccaaggatctcaagatgctgcgt
gtggtggttcgcgaggacttcagcaagagtaggtgtgaccagctgctggcggatatcaaa
ctgtgcattggcgtcctggatgacatggacaagaacgaggtggtgcgttccgagaagtat
atcaaggagcatcagagccacagtgggcgctcgggacataaccacgaggcgtataggaag
gagaagcatagtctgcagggcaaaacggggaagacgcatgcgatttgctaa

DBGET integrated database retrieval system