KEGG   Marssonina brunnea: MBM_01461Help
Entry
MBM_01461         CDS       T03105                                 

Definition
(RefSeq) succinate dehydrogenase subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mbe  Marssonina brunnea
Pathway
mbe00020  Citrate cycle (TCA cycle)
mbe00190  Oxidative phosphorylation
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01200  Carbon metabolism
Module
mbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbe_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MBM_01461
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MBM_01461
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MBM_01461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 18757396
NCBI-ProteinID: XP_007289350
UniProt: K1Y6E3
LinkDB All DBs
Position
Unknown
AA seq 654 aa AA seqDB search
MSSFAMRKFTSAPSLIPPRSQLSKALRNQTRAFSATRSAARIITHAPLRAKEASPFVSNK
YPVVDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNM
HEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGKIYQRAFG
GQSQKFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAMDLIMEDGECKGV
IAYNQEDGTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQ
FHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREG
RGVGPDKDHIYLQLSHLPAEVLHERLPGISETASIFSGVDVRKQPIPVLPTVHYNMGGIP
TKYTGEVLTVDEAGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTVRD
NFEPGMPHKEISADAGAESISMLDKIRTADGPLSTHEIRLKMQKTMQTDVSVFRTQESLD
EGVKKINEVDQLFKDVGTKDRSMIWNSDLVETLELRNLLTCAVQTAESAAARKESRGAHA
REDFPDRDDNNWMKHTLSYQKTPHGKTDLSYRGVVAHTLDEAECAAVPPFKRVY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgttcgcaatgcgaaaattcacatctgccccttcgctaatccccccgcgttcc
cagctgtcgaaggcgttaagaaatcaaacaagagccttctctgcaacgcgatccgctgct
cgcatcatcacacacgcgccgctccgagcgaaagaagcctccccgttcgtcagcaataaa
taccccgtggtggaccatgagtacgatgcgattgttgtcggtgccggcggagctgggctg
cgcgcagctttcggtctcgccgaggcaggcttcaacaccgcatgtatatcgaagctcttc
ccaactcgaagtcataccgtagccgcccaaggaggaatcaacgctgcgctgggtaatatg
cacgaggacgactggagatggcacatgtacgatacggtcaagggctcggattggctcgga
gatcaggatgctattcattatatgacgagagaggcaccacaatctgttattgagttagag
aactacggctgtcccttctcgagaacggatgacggaaagatttatcaacgtgctttcgga
ggccaatcgcaaaagtttggaaagggaggacaggcatacagatgctgtgccgccgctgac
agaactggacacgccctcctacacacactctatggtcaatctcttcgccataacaccaac
tatttcattgagtactttgccatggatttgattatggaggatggcgaatgcaagggtgtt
atcgcatacaaccaagaggatggtactctgcacagattcagagcacacaacactgttctt
gctactggtggttacggacgtgcctacttcagttgtacatccgcccacacttgcacaggt
gacggtatggctatggttgcccgtgctggtctgcctaaccaggatctcgaattcgtccaa
ttccacccgactggtatctacggagctggctgcttgatcaccgagggtgctcgtggagaa
ggtggatacctcctcaactcggagggagagcgatttatggagagatacgcaccgactgcc
aaggatcttgcatctcgtgatgtcgtttcccgatcgatgactatggagatccgtgaaggt
cgtggtgttggcccggataaggaccacatctacctgcaactcagccatttgcccgccgag
gtccttcacgagcgtctcccaggtatctctgagaccgcatctatcttctccggtgtcgac
gtccgcaagcaacctatcccagttctccccaccgtgcactacaacatgggtggcatccca
accaagtacactggtgaagtcctcacagttgacgaggctggtaaggacaaggttgtacca
ggtctgttcgcttgtggtgaagctgcttgcgtgtctgtgcacggggccaaccgcttggga
gccaattccctcctggatttgatcgtcttcggtcgtgccgtatcccacaccgtccgtgat
aacttcgagcccggcatgccacacaaggagatcagcgccgatgcaggtgccgagtccatt
agcatgctcgataaaattagaaccgccgatggcccactgagcacccacgagatccgcctg
aagatgcagaagaccatgcaaacagatgtcagcgttttcagaacccaagagtctctggat
gagggggtgaagaagatcaacgaggttgaccagctgttcaaggacgttggaaccaaggat
cgaagcatgatctggaactcggatttggttgagactttggagttgagaaacttgttgact
tgcgccgtccaaaccgccgagtcagcggccgccagaaaggagtcccggggagcccacgcc
cgcgaggatttcccagaccgcgacgacaataactggatgaagcacacgctgagttaccag
aagacgccacatggcaagacggatcttagctacagaggtgtcgtcgcgcatacgttagac
gaggccgagtgtgcggctgtgcctcctttcaagcgtgtctactag

DBGET integrated database retrieval system