KEGG   Marssonina brunnea: MBM_02085Help
Entry
MBM_02085         CDS       T03105                                 

Definition
(RefSeq) histone deacetylase domain-containing protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
mbe  Marssonina brunnea
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mbe03036]
    MBM_02085
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MBM_02085
Chromosome and associated proteins [BR:mbe03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     MBM_02085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl SP2
Motif
Other DBs
NCBI-GeneID: 18758020
NCBI-ProteinID: XP_007289974
UniProt: K1XHC0
LinkDB All DBs
Position
Unknown
AA seq 1198 aa AA seqDB search
MHAPSPGSTRTSCNLRQTPKNKKKKKKKKKKNISSSAGVSRIEAKNLPPGSSRRHSWAWR
GLPSPDVALKPPKCTRSVQGQRSAADDGFVSKPVPRLSTLPIPPEALPQPRRLSITKSRT
HSRSSTPTLLRKASMNSQHGVGGASVTPSRNSSSSRQSTGAQFTNASALVGKSPLSEIED
QVPAPPKYTAASIASNHFKEELDLHEKGEDTRSADTIVILHDAVYGHRYSRPRTSKASLS
TIVERPERIHASILGLSAAYVCLGERHADGQFPLHPDRDVSSMPSLPFCIRKTTRKMTIS
SQAVTNVHGAKWMEELKIMCDSAESRLAMNGKELTRPNMNRSPDEKVPEKLHEGDLYLCA
ESLDAMEGALGAVCEGVDAVFQGSASGKGPFRTFVAIRPPGHHCSASYPSGFCWLNNVHV
GISYAALSHGLTHAAIIDFDLHHGDGSQAIAWESNRRATSAPKNAHQWKKTSIGYFSLHD
INSYPCEVGDEEKVKNASLCIENAHGQSIWNVHLQPWKSENEFWELYETKYSILLEKTKS
YLRTQTDRLRSMPHGPKPRGAIFLSAGFDASEWESSGMQRHKVNVPTEFYARLTRDVVEL
AGEEGLAVDGRIISVLEGGYSDRALCTGVLSHLSGMSAGDPMVISKERSPTGLGHEMSTK
IGTFDGKIAPETSTAGSQVQDYDPSWWSVARLEQLDAVVHQGPIPSEPRRPRYAPAPTYS
SPTQSFIAKVSSPSARKNVANMGVRNGSPRAPLRAPSPPPPEVDWAVAAHELSKLLIPTD
RQTMSCRQEDLSAEATRARRDRQSVMTPPTTAEPVETSTGRMALRARKPAKPLVESDEDG
VKKPVAKASRRKTVAGAALLAGSTAPSRSTTPMPDYTKPTAQSSRRLSLSSNAGSVISEV
PPRKNGYRVASNGRLSTRPGTAQSVRPESSMSVRGQSAAPTAVKKTRAPVQPREAPKVSR
VRRKSPLNNSGVAPTSDIDSLTSGMKKVKISLTTKAQREAKAAAAKPAAPKSPRPAPSTK
EVATPPRQSAASSTAGDVTPAPPQPEPVAASTPKLPSTPRPPVPTDLQKPARVSLTASSP
LSPPVPHNGSNASCPAKPIQPSSAAAPDVFIPYQPKGPLPLALAAQEHPLQWLEPNTNTP
SPMKVGQKKGNNLPVFTSTSAIPFGFPNPNGVKKQRELNGISKGDRMEGIVKSEEMKK
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaccttcgccaggcagcacgcgaacttcgtgtaatctacgtcaaactccgaag
aataagaagaagaagaagaagaagaagaagaagaacatatcctcatccgccggcgtcagt
cgcatcgaagccaaaaacctcccccccggatcctctcgtcggcatagttgggcgtggcgt
ggcctacccagtccagatgtcgcactcaagccccccaaatgcacacgatctgtccaaggc
cagaggagcgccgccgacgatggcttcgtctccaaaccagtaccaagactatcaactctc
cccatccctccggaagctctccctcagccgcgccgcctctccatcaccaagtctcgcact
cactcgcgctcttcgacaccgacactgcttcggaaagcctcgatgaactcccagcatggc
gtgggtggcgccagcgtgacaccttcgcgaaattcttcctcctcgcgccaatccaccggc
gcgcagttcaccaacgcttctgccctggtgggcaagtcccccctctccgagatcgaggac
caggtgccagcgcccccaaaatataccgcggcgagcattgcaagcaatcacttcaaggag
gagctggacttgcatgagaagggagaggatacgaggtctgcggacacaatcgtaatatta
cacgatgctgtctatggccaccgatattcgaggccgcgaacatccaaggcgagcctgagc
acgattgtggagaggccagagaggatacatgcgagcattctgggactatcggcagcatat
gtatgtctgggggagcggcacgcggacgggcagtttccactgcacccagatagggatgtc
tcttcgatgcccagcctgccgttttgcattcgcaagaccacgcgcaaaatgaccatctct
tcgcaggcggttacgaatgtgcacggggccaagtggatggaggagctgaagatcatgtgc
gacagtgcagagagcagactggctatgaatgggaaggagttgacgagacctaatatgaat
cggagtcccgatgagaaggtgccggagaagcttcatgaaggtgatctttacctgtgcgcg
gagtcgctggatgccatggagggagctttgggcgctgtgtgtgagggtgtggatgccgtt
ttccagggttctgcgagtggaaagggaccgttcaggacatttgttgcgattcggcctcct
gggcatcattgctcggcgagctacccttctggcttctgctggttaaataatgtgcatgtg
ggcatctcttacgcggcattaagccatggtctgacccatgcggcgatcatcgactttgat
cttcaccatggagatggatcgcaagctattgcgtgggaaagcaacaggcgcgccacatct
gctccaaagaatgcgcatcagtggaagaagacctcgatcggatatttcagtcttcacgat
atcaactcttacccctgtgaggtgggcgacgaggagaaggtcaagaacgccagtctttgc
attgagaacgctcatggtcagagcatctggaatgtccacttacagccgtggaagagtgag
aacgaattctgggaactgtacgagacgaagtattcgattcttctggagaagactaagagc
tatctgcggacacagacggatcgcctacgatcaatgccccatggaccgaagcccaggggg
gccatcttcttatctgccggattcgatgcaagtgaatgggagagttcggggatgcaacgc
cacaaggtcaatgtgcctacggagttttacgcgcgcttgaccagggatgttgtcgagctg
gctggtgaagaaggtctcgcggttgatggtcgaattatcagtgttctcgaaggaggctat
agtgatcgagctctgtgcaccggtgtgctaagtcatctgagtggtatgtctgctggcgac
cccatggttattagtaaggaacgcagtccgacagggcttggacatgaaatgagcacgaag
attggcaccttcgatggaaagattgccccggagacttcgactgcaggttcacaagtccag
gattacgatccctcatggtggtctgtagctcgactcgagcaacttgatgctgtggtccat
caaggaccgattccctcagagcccaggaggccacgatacgctccggcaccgacatattcg
tccccgacccaatcttttatcgccaaagtgtcctctccgtcggccagaaaaaacgttgcc
aacatgggcgtgcgaaatgggtctcctcgtgcccccttgagggcaccatctccgccccct
ccagaggtcgactgggcggtagctgcccatgaactaagtaaacttctcattccaaccgac
agacagactatgagctgcaggcaagaagatctgtctgcagaagccactcgtgccaggcga
gaccggcaatctgtcatgacaccacccaccacggccgagcctgtggagacgtcaactggt
agaatggctttgagggcgagaaagcctgcgaagccgcttgttgagagcgacgaggatggg
gtcaagaagcctgtcgcgaaggccagccgtcggaagactgttgctggggccgctcttctt
gccggtagtactgcgccatcaaggagcacaaccccgatgccagactataccaaacccacc
gctcaatccagccgtcggctcagcttatcttccaatgctggatctgtgatttcggaggta
ccaccgcgtaagaacggctacagagtagcatctaacggaagactgtcaacgcggcccgga
actgctcaaagtgtccgaccagaatcttccatgagcgtgcgcggccaatctgctgcgcca
actgcggtcaagaagacgagagcaccggttcagcctagggaggcccccaaggtttcgcgc
gttcgcagaaaatcgccactcaataatagtggcgtagcgcctacctcggatattgacagt
ctgacctcgggaatgaaaaaagtgaagatcagtctgacgaccaaagcgcagcgagaggca
aaggcagcagctgcgaagcctgcagcccccaaatctccaagaccagcgccgtcgacgaaa
gaagttgcaacacctccgcggcaatctgcagcttcatcaacagctggtgatgtgaccccc
gctccaccacagcctgagccggtagcagcgtctactcctaaactaccatcaacacctcga
cctccagtcccaacagaccttcagaaaccagctcgggtttctctcacggcctcttcgcct
ctttcgccgcctgtgccgcataacggtagcaacgcgtcctgccctgcaaagcccatccag
ccttcttctgctgccgcccctgatgtctttattccctatcaacccaaaggtcctctgcct
ctggcgctggcggcgcaagaacatcccctgcagtggttagagcccaacactaatacgccg
agtccaatgaaggtgggccagaaaaagggaaataacttgccggtcttcacgagtactagt
gcgattccattcggatttccaaatccaaatggcgtgaagaagcagagggaattgaatggg
attagtaagggggacagaatggaggggattgtaaagagcgaggagatgaagaagtag

DBGET integrated database retrieval system