KEGG   Marssonina brunnea: MBM_03122Help
Entry
MBM_03122         CDS       T03105                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mbe  Marssonina brunnea
Pathway
mbe00052  Galactose metabolism
mbe00500  Starch and sucrose metabolism
mbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MBM_03122
   00500 Starch and sucrose metabolism
    MBM_03122
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MBM_03122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18759057
NCBI-ProteinID: XP_007291011
UniProt: K1WME3
LinkDB All DBs
Position
Unknown
AA seq 976 aa AA seqDB search
MLRHFPTALALLASAVSGVAVSEKQYTATDARDGCPGYVASNIVQTGTGLSASLKLGGTA
CNVHGTDVPELKLTVNHDTGLESRLHVKIEDAGQIAYQVPTSVFPTPSANGSVSPAAATL
EFSYETSPFSFKVTRRSNGEILFDTSAATMIFEDQYLRLRTALPDDPNLYGLGEHTDSLR
LNTTGYTRTLWSRDGYLVPSGQNLYGNHPIYFDHRGEKGTHGVFMLSSAGMDVKINRTEQ
DGQYLEYNMMSGILDMYFLSGPSPIDVAKQYSEVTRKAAMMPYWGFGYHQCRYGYRDFYS
IAEVVYNYSMAGIPLETMWTDIDYMYERYIMTTDPDRFPVARVREYVDYLHDHHQKYIVM
VDPAVAFQTERENGLPYETFLKARDQGILLQKNGSIYQGVVWPGITAFPDWFHPDTQKFW
DDEFAEFFNADTGVDIDGLWIDMNEAANFNYFGDDPQESAEERVSNFTLDTDIVHYDGHV
ELDVHNIYGAMMSAASRTALINRRPRRRPMVITRSTFAGSGHTVGKWLGDNMSTWELYRN
SIQGMLGFAAIYQVPMVGSDVCGFAGNTTEVLCARWATLGAFNPFFRNHNGDYSSPQEFY
VWASVTAAAKNAIDIRYRLLDYIYTALYQQSVDGTPLLNPMFFLYPADRHTVGVDLQFFY
GDALLVSPVTEENATHVEIYLPRDTFYDFKTYAKIEGEGAKLNLTDIPLTEIPLHVRGGC
VVPMRNASGATTTDVRAQPFNFFVAPDAEGRAVGRLYLDDGESLVQEATSEIALTYGDGE
LLVGGSFGYRAEGNWLHEVIVLGVEVEPEGAYWSQGVVDGGATTVWVACPLGEGWRWDAE
RKALIIKVGRMLDEAIRVKFEGGLAQKPTASEVATTDVVRTVLNSPGPNVYFSQVTPFRA
QEASTQGGSVRRWLLKEDLTSNEMHDEALEMFIERREAGLKTLTGEELAESDKQMIWAQR
GREKGYPSLNQLEDEI
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcactttcccacagcccttgcgttgttagcaagtgctgtgtcgggcgttgct
gtctcggagaaacagtatacggctacagatgcgagggatggctgtccaggatacgttgcc
tctaatatcgtgcagactggaactggcttgagtgcaagcttgaagctcggggggacagct
tgcaatgtccatggtaccgatgtgcctgagttgaagctcaccgtcaaccacgatactgga
ttagaatcacgacttcacgtcaagatcgaagatgcaggacaaatcgcctaccaggttccc
acctccgtcttcccaactcctagcgccaatggctccgtctccccagcggctgccacgcta
gagttctcctacgaaacgtcgcctttcagcttcaaagtcacgcggagatccaatggagag
atcctcttcgacaccagtgccgcgacgatgatattcgaggaccagtacctacgactccgg
actgcgctgccggacgacccaaacctttacggcctcggtgaacacaccgattcgttgcgg
ctcaacaccacgggctacacgcgcaccctctggtctcgcgatggctaccttgtaccgtcg
ggacagaacctgtacggtaaccacccgatctacttcgatcaccggggcgagaaggggacg
catggcgtctttatgctttctagcgccggcatggacgtcaagatcaaccgcacggagcag
gacgggcaataccttgaatataacatgatgtccggaattcttgacatgtactttctcagc
ggaccgagtccgatagatgttgcaaagcagtattcggaggtcacccggaaggcggctatg
atgccgtactggggctttggataccaccagtgccggtatggctatagggatttctactcc
atcgccgaggtggtgtataactactcgatggcggggatcccgttagagacaatgtggacg
gatatcgactacatgtacgaaaggtatatcatgacgacggatcctgatcgcttcccagtt
gcgagagtcagggagtacgtcgactatttacacgatcaccatcagaagtacattgtaatg
gttgaccctgccgtggcatttcaaacagagcgagaaaatggattgccatatgagactttt
ttgaaggcccgagaccagggtatcttattgcagaagaacggatctatctatcaaggtgtt
gtttggcccggtatcactgcgttccccgactggttccaccccgacacgcagaaattttgg
gacgacgagttcgcagagttcttcaacgctgacacgggtgtcgatatcgacggactctgg
atcgacatgaacgaggcagccaacttcaactactttggcgacgacccgcaagagagcgcc
gaggagcgcgtttcgaatttcacgctcgacaccgacattgtacactacgacgggcacgtc
gagctggacgtccacaacatctatggcgcgatgatgagcgcggcctcacgtactgctctc
atcaaccgtcgaccgcgccgccgtccaatggtcatcacgcgctcgaccttcgccggctct
ggccacaccgtgggcaagtggcttggagacaacatgtcaacctgggaactgtatcgcaac
tcgatccaaggcatgctcggtttcgcagcgatctaccaagtccccatggttggctccgac
gtctgtggcttcgccggtaacacgaccgaggtgctgtgcgcgcgctgggccaccttgggg
gcgttcaaccccttcttccggaaccacaacggcgactattcgagcccgcaggagttctat
gtctgggcgagcgtgaccgcggcggccaagaacgccatcgacatccgctaccggctgctc
gattacatctacacggccctgtaccagcagagcgtcgacggcaccccgctcctcaacccg
atgttcttcctctatcccgcggaccgccacaccgtcggcgtggacctccagttcttctac
ggcgacgccctcctcgtctcgcccgtcacggaggagaacgccacccacgtcgagatctac
ctcccgcgcgacaccttctacgatttcaagacgtacgcgaagatcgaaggggagggcgcg
aagctcaacctgacggacatcccgctcaccgagatcccgctgcacgtccgcggcggctgc
gtcgttccgatgcgcaacgcttcgggcgctaccaccaccgacgtgcgcgcgcagccgttc
aacttcttcgtggcgcccgatgcggaggggagagccgtcgggcggctgtatctagatgac
ggcgagagtctcgtgcaggaagccacgagcgagattgcgctgacgtatggcgacggggag
ctgctcgtcggaggctccttcgggtaccgggccgaggggaactggctgcatgaggtgatt
gtgctgggtgttgaggtggagcccgagggcgcgtactggagccagggggttgtggatggg
ggggcgacgacggtttgggttgcttgtcctctcggtgaggggtggaggtgggatgctgag
aggaaggcgttgataattaaggtcgggaggatgttggatgaggcgatccgggtgaagttc
gaaggcgggcttgctcagaagccgaccgcttctgaagttgccaccacggacgtcgttagg
acagtcctcaatagcccgggtcccaacgtctacttttcgcaagtgacgccgttccgagct
caagaggcttctacacagggggggagcgtgcgtcgatggctattgaaagaggaccttacg
tccaacgagatgcacgacgaagcgcttgagatgttcatagagcgcagagaagcaggcctg
aagacgcttactggggaagagctcgccgaatccgacaagcagatgatatgggcccagaga
gggcgagagaaaggctaccccagcttgaatcaacttgaggacgagatctag

DBGET integrated database retrieval system