KEGG   Marssonina brunnea: MBM_03149Help
Entry
MBM_03149         CDS       T03105                                 

Definition
(RefSeq) hypothetical protein
Organism
mbe  Marssonina brunnea
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 Cellulose_synt
Motif
Other DBs
NCBI-GeneID: 18759084
NCBI-ProteinID: XP_007291038
UniProt: K1X1L3
LinkDB All DBs
Position
Unknown
AA seq 874 aa AA seqDB search
MASRNIVGLEMADIKSNDGNDHYTSGLDIPVATRSRRSTLANSNPNNNSSSSNSNTWSHH
SGDSSTWVGGGSAVSEEWPNSALPERHSFLESVPGSGPATPIDIDSRPTSPCFYQGNGSS
QSHHSLAPLMKPHHTSKSTSGLSSEYTFTEDSIAHLHKRDDVEIFKGWRRKVSRFMPFLM
FGNTFLYFAYLGLRIACVIMAQNSQNTIYAGAWAFLAVEILVAIPSQMHNFLLMCGLKKR
QRPKLRLRGEDGPTVDVFVTCCGEDDEIVLDTVRAACDQDYPRDRFRVIVLDDGKSAGLE
AYINQLAGVYENVFYIARPKFPGVPHHFKAGNLNYGLEQVDLMGPGEFMAALDADMIPER
DWLRALLPHLLIDPKMALACPPQLFYNTPVSDPLAQSLNFFVHVIEPIKDALGVAWCTGS
GYIFRREALTEIGNFPTGSLAEDVATSTMVIGKGWKTSYIHEPLQFGTVPEDFAGHLKQR
TRWAVGTVQTATKLNFCLYGDSVRSMTVAQRLLGALYAMLGIFTVLLTLSMFVVPIVLAW
GKPLVAFSTVTQLRWLIWGASASVACNRLCEVAMSSPSGYHTSQRDSRSQFWMSPYLALS
IMRAFILPRWLGGNVVAFKPTGSLGSALNERDAQNRKSMPRRLFTILFNYMAIFHFVFVY
FTLAAVAVTSYKVFFAPDTSLRGIFIGLTIHVFWPPMTFLFLVSSLWTPIAYAIDPPVMP
EREALLQRDQKTGIAHPTEASKRIAFSGQEVWFEFLYTVSTNRKARSHHAGPTNLGAHQA
GRFGHLYQACSRIPGDRTARIPSSVTRRNFQARLSSIWTIGSCLSCAKSEPMPPAANYCE
HYSHCSYIHDTAIASAVGYVQVTDLSRVKTSPDV
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacgcaacatcgtgggtctcgagatggccgacatcaagagtaatgatggcaat
gaccactacaccagcggtctcgatatccccgtggctacgaggtcgcggcggtccacgctt
gccaacagcaaccccaacaacaacagcagcagcagcaacagcaatacctggtcgcaccac
tcgggagactcctctacctgggtaggcggaggaagtgctgttagtgaggagtggccaaac
tcagcactgcccgagaggcactcgttcctggagtcggtgccaggatctggaccagcaacg
cccatcgatatcgattcgcggccaacgtccccctgtttttatcagggcaatggctcttca
cagagccatcacagtctcgctcccctcatgaagccgcatcatacctccaaaagcacctcg
ggactctcctccgagtacaccttcaccgaagattccatcgcccacctacacaaacgtgac
gacgtggaaatttttaagggctggcgccgcaaagtgtctcgattcatgccctttctcatg
ttcgggaataccttcctgtactttgcgtacctgggcttgcgcatcgcttgcgtgatcatg
gcacagaattcccagaataccatatatgcgggcgcgtgggccttcctggcggtcgaaatc
ctcgtcgcgatcccgtcacagatgcacaacttcttactcatgtgtgggttgaagaaacgc
cagcggcccaaactgcgcctgcgtggcgaagacggccccacggttgacgtctttgtcacc
tgctgcggagaggatgacgagatcgtgcttgatactgtccgtgctgcctgcgaccaggac
taccctcgggaccgcttcagggtgatagtgctagacgacggaaagtcggctggcctggag
gcgtacatcaaccagctcgccggcgtttacgagaatgtgttctacatcgcacggcccaag
ttccccggggttccgcaccatttcaaggctgggaatctcaactacgggctcgagcaggtg
gacctgatgggcccgggcgagttcatggctgcgctggatgccgatatgattcctgaacgc
gactggctgcgtgcccttctccctcatctgctcattgaccccaagatggcgctcgcgtgc
ccaccacagctgttctacaacacgcccgtctcggatcctctcgcgcagagtctgaacttc
tttgtccacgtgatcgagcccatcaaggacgcccttggggtggcatggtgtaccggttcc
ggctacatcttccggcgagaagcacttaccgagatcggcaacttccccaccggatccctc
gccgaagacgtggcgacgtcgacgatggtgataggcaagggctggaagaccagctacatc
cacgaaccgctgcagttcggcacggttccggaagacttcgccgggcacctgaagcagcgc
acgcggtgggccgtcggcacggtgcagacggctaccaagctgaacttctgtctgtacggt
gacagcgtgcggtcgatgaccgtggcacagcgcctcttgggcgccctgtacgccatgctg
ggcatcttcacggtgctgctgaccttgtcgatgttcgtagtccccatcgtgctcgcgtgg
ggcaagccgctcgttgccttcagcaccgtcacgcagctgcgctggctgatctggggcgcc
tccgcctccgtggcctgcaaccgcctctgcgaggtcgccatgtccagtccgtctggctat
cacacgagccaacgcgactcgcgctcccagttctggatgtcgccgtacctggcgctgtcc
atcatgcgggccttcatcctgccccggtggctgggcggcaacgtcgtcgccttcaagccg
acgggctcgctcggctcggccctgaacgagcgtgatgcccagaaccgcaagagcatgccg
cgccggttatttaccatccttttcaactacatggccatcttccacttcgtcttcgtctac
ttcacgctcgccgccgttgccgtcacttcctacaaggtgttcttcgccccggataccagt
ctgcgtggcatcttcatcggcctcaccatccacgttttctggccgcccatgactttcttg
ttcctggtctcctcgctgtggacgcccattgcttacgcgatcgacccgcctgttatgccg
gagcgggaggccctactccagcgggatcagaagacgggtattgcgcacccgactgaggcc
agcaagcggatcgcctttagtggccaggaggtctggttcgagtttttgtacaccgtgtcg
acgaacagaaaggcacgtagccaccatgcaggtccaacaaatctgggagcacatcaggcc
ggtcgttttggtcatttgtaccaggcttgttctcgtataccaggtgaccggactgctcgt
atcccctcgagtgtcactcgccgaaattttcaagcccgtttgagttcgatatggacgatt
gggtcttgcctatcctgtgctaaaagcgaacccatgccacctgcagcaaattactgcgag
cattatagccattgcagctacatccacgatactgcgattgcaagcgctgtcggatatgtt
caggtgacagacctatcacgtgtcaagacctctccagatgtataa

DBGET integrated database retrieval system