KEGG   Marssonina brunnea: MBM_04113Help
Entry
MBM_04113         CDS       T03105                                 

Definition
(RefSeq) oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mbe  Marssonina brunnea
Pathway
mbe00020  Citrate cycle (TCA cycle)
mbe00310  Lysine degradation
mbe00380  Tryptophan metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01200  Carbon metabolism
Module
mbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MBM_04113
  09105 Amino acid metabolism
   00310 Lysine degradation
    MBM_04113
   00380 Tryptophan metabolism
    MBM_04113
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MBM_04113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 18760048
NCBI-ProteinID: XP_007292002
UniProt: K1XY65
LinkDB All DBs
Position
Unknown
AA seq 1047 aa AA seqDB search
MLQSSLRQKSCQLLKVGSVARSLSTASRTSPLLSPKSSAVSSKRTSAATGQKRYAAAVAN
APDPNDSFLSGNTANYIDEMYMQWKEDPKSVHISWQVYFRNMESGDMPMSQAFTPPPNLV
PVPTGGVATFTPGVGMAAGQGSDVTNHLKVQLLVRAYQARGHHKAKIDPLGIRREAEEFG
SSNPKELQLEHYSFTEKDLDTEYNLGPGILPRFKKEGREKMSLRDIIAACERIYCGSYGV
EYIHIPDREQCDWLRQRVEVPQPFKYSVDEKRRILDRLIWSSSFESFLATKYPNDKRFGL
EGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFGGSAAAE
DEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKAH
NTAMGVLLHGDAAFAAQGVVYECLGFHSLPAYSTGGTIHLVVNNQIGFTTDPRFARSTAY
CTDIAKAIDAPVFHVNADDVEAVNYVCQMAADWRAEFRKDVVIDLVCYRKHGHNETDQPS
FTQPLMYKRIQAHEPQIDIYVNQLLKDGSFTKEDIEEHKKWVWGMLEDSFTKSKDYQPTS
KEWTTSAWNGFKSPKELANEVLPHNPTGVPLGTLEHIGTTIGTAPEGFNVHRNLKRILAS
RVKTVTEGTNIDWSTAEALAFGSLVQEGHHVRVSGQDVERGTFSQRHAVFHDQETEKTYT
PLQHISKDQGKFVISNSSLSEFGCLGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQF
VASGEVKWMQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLSNEDPRIYPAPEKLDRQHQD
CNMQIAYMTTPSNLFHILRRQMRREFRKPLVIFFSKSLLRHPLARSPIEEFTGNSQFKWI
IPDPEHGKSIAEPDDIDRVILCSGQVYAALHKYRADKGFKKTAITRIEQLNPFPWQQLKE
NLDTYKNAKTIVWCQEEPLNAGAWSFTQPRIETLLNQTEFHDRKHVMYAGRNPSASVATG
LKASHTKEEADLLEIAFSVTQDKLKGE
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaatcttctctgcggcagaagagctgccagctcctgaaagttggcagcgtcgcc
agatctctcagtaccgcatcacgaacatctcctctcctgtccccaaagtcctcagcggta
tcctcgaaacgaacttcggctgccactgggcaaaaacgctatgccgctgccgtggcgaac
gccccggatccgaacgacagctttctgtccggaaataccgcaaattacatcgatgagatg
tacatgcagtggaaggaagatccgaagagcgtgcatatctcatggcaggtatactttcgc
aatatggagagcggcgatatgcccatgtcgcaagccttcacacctccaccgaatctcgtt
cctgtgcccaccggcggcgtcgcaaccttcactcctggagtcggcatggctgctggtcag
ggctcggatgtaaccaaccacttgaaggtacaattacttgtgcgagcataccaagctcgc
ggacaccacaaggcgaaaatcgaccccttgggcattcgtcgcgaggctgaggagttcgga
tctagcaatcccaaggagctacagctcgagcactactcgtttacggagaaggatttagac
accgaatacaaccttggccctggtatcttgccgcgattcaagaaggaaggccgtgagaag
atgagcttgcgtgacatcattgccgcatgcgagcgcatctactgcggttcttacggagtc
gaatatatccacatcccagatagagaacagtgcgactggctccgccagcgtgttgaagtt
cctcagcccttcaaatattccgttgatgagaagcgccgaattcttgaccgtctcatctgg
agttccagcttcgagagctttttggcaaccaaatatcctaacgataaacgttttggtttg
gagggttgtgaaacattggtccctgggatgaaagccttgattgacagaagtgtggattat
ggtgtcaaggatattgtcatcggtatgccccatcgtggtcgtttgaacgtcctttccaac
gtcgtccggaagcccaacgaatctatctttagcgagtttggaggaagtgctgcggctgaa
gacgagggatccggtgatgtaaagtaccatctcggtatgaactttgagcgccctacccct
tctggaaagcgtgtccagctttcacttgtggccaacccttcccatttggaagctgaggat
cctgtcgtcttgggtaagaccagagctattcagcactacaacaacgatgagaaggctcac
aacactgccatgggagtcctcctccacggtgatgccgcctttgctgctcaaggagttgtc
tacgaatgtcttggtttccactctttgcctgcttactcgactggtggtactatccaccta
gtcgtcaacaaccagattggcttcactactgaccctcgtttcgctcgttcgactgcctac
tgtaccgacattgccaaggctattgatgcgccagtcttccacgtcaacgctgatgatgtt
gaggctgtcaactacgtttgccaaatggcggcggattggcgcgccgagttccgcaaggat
gttgtgattgacctcgtctgttaccgcaaacatggacacaacgagactgatcaaccttcc
ttcacccaaccacttatgtacaaacgcatccaggcacacgaacctcaaattgatatctat
gtcaaccaactcttgaaagatggcagcttcaccaaagaggatatcgaagagcacaaaaaa
tgggtctggggcatgttggaggacagctttaccaagagcaaggactaccaaccaacttcc
aaggagtggaccacatctgcttggaatggtttcaagtctcctaaggagcttgccaatgaa
gtcctaccccacaaccctaccggtgttcccttaggcactctcgagcacatcgggactacc
attgggacggcgccagaaggcttcaatgttcaccgcaacctgaagcgcatccttgccagc
cgtgttaagactgtcactgaaggcaccaacatcgattggtctactgctgaggctcttgct
ttcggatctctggtccaagaaggtcaccatgttcgcgtttctggtcaggatgtcgagcgt
ggtactttctctcaaaggcacgccgtgttccatgaccaggagactgaaaaaacgtacacc
ccacttcaacatatcagcaaggaccaaggcaagttcgtcatctctaactcttcactgagt
gagtttggctgtcttggattcgagtatggatactcgctttcatcaccaaacgccctcgtc
atgtgggaagctcagttcggtgatttcgccaacaatgctcaatgtatcattgatcaattc
gttgcctccggtgaagttaagtggatgcagagatctggtcttgtgatgtcgttacctcac
ggatacgatggacaaggtcccgagcattcgtctggacgcatggagagatatctgcaactc
agcaacgaggacccacgcatttacccggccccagaaaagctggatcgccaacatcaagac
tgcaacatgcaaattgcttacatgaccactccctcgaacttgttccacatcctgagaaga
cagatgcgcagagaattccgcaagcccctcgtcatcttcttctccaagtctcttctccga
cacccacttgcccgctcacccattgaggagttcaccggtaattcgcaattcaagtggatt
atccccgaccccgagcacggcaagtccatcgccgagcccgatgacattgatcgcgtcatc
ctctgctccggacaagtttacgccgctctccacaagtaccgtgccgacaagggcttcaaa
aagactgccattactcgtattgagcaactgaaccccttcccgtggcaacaactgaaggag
aacctcgacacatacaagaacgccaagaccatcgtctggtgtcaagaagagcctctcaac
gctggagcctggagtttcacccaacccagaatcgagaccctgctcaaccagaccgagttc
catgaccgcaagcatgtcatgtacgctggtcgcaacccaagtgccagtgtggctacgggg
ttgaaggctagccatactaaggaggaggctgatttgttggaaattgctttctctgttacc
caagataagctaaagggcgagtaa

DBGET integrated database retrieval system