KEGG   Marssonina brunnea: MBM_04310Help
Entry
MBM_04310         CDS       T03105                                 

Definition
(RefSeq) putative Glucoamylase P
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mbe  Marssonina brunnea
Pathway
mbe00500  Starch and sucrose metabolism
mbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MBM_04310
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MBM_04310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18760245
NCBI-ProteinID: XP_007292199
UniProt: K1XXC2
LinkDB All DBs
Position
Unknown
AA seq 612 aa AA seqDB search
MRFSSSSSSSSSSILASFVSLVTAAAAAGPLQAPDLSSFIAQERAIALQGVKNNVGPSGS
KASGAGAGFIVASPSKVDPPYFYTWTRDSALTMKMIVDEFLLGKRELQSYIEDYIHAQAV
LQTVANPSGTFLPAGLGLGEPKYQVDGTRFNGAWGRPQRDGPGLRAIANGQSEKAREIIW
PIISNDLSYVGQYWNSTGFDLWEEVQGSSFFTVQAQHRALVEGTALAKSLNVNCTGCDQA
PQALCFLQSFWNGKYIVSNINVDNGRSGLDGNSILGSINNFDINATCSDETFQPCNSKSL
ANFKALIDTFRDAYTINKGIPKDKGVAVGRYTEDTYQGGHPWYLITTAAAEFLYDAVAQW
KARQVLYVDATSLAFFQDLYPAVTVRQYNSGDANSPFAQIMDAVTAYAESFVAVVQQYTP
ADGSLAEQFNRDSGVPLSAADLTWSYAAFVTMAERRAGEYPPSWNTRHVAPVPTACAGTS
TPGVYVPATAAGAPNVTTGCQINVQFNVNASTYFGENLYVSGSSTDLGAWDLGNAIPMGA
GGYTSERPLWSVSTYLPAGQTVDFKYVREQNCNQAPIFESQDRTLVVPACGSAAVVTDDA
WVGPVGTSGNCS
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctcctcctcctcctcctcctcctcctcctccatcctcgccagctttgtgtct
ctcgtcaccgctgccgctgccgcaggaccgctccaagcaccggacttgagctcgttcatt
gcgcaggagagggccatcgcactgcagggcgtcaagaacaatgttggacccagtggaagc
aaagcgtctggagctggtgcaggcttcatcgtggccagtccgtccaaggtcgatccgccc
tacttctatacgtggacccgtgattcggctctcacgatgaagatgattgtcgatgagttt
ctcctagggaagagggagttgcagtcctacatcgaggattacattcacgcccaggctgtc
ctccaaacggtcgccaatccgtcagggacttttctcccggctggtctggggcttggagag
cccaagtaccaggttgatgggacgagattcaatggggcttggggacgtccccagcgtgac
ggacctggtttacgggcaatcgcaaacggccagtccgagaaagccagagagatcatctgg
ccgattatttccaacgatctgtcctatgtcggccagtactggaattctaccggctttgac
ctttgggaagaagtccaaggctccagcttcttcactgttcaagctcagcacagagcactc
gtcgaaggcaccgcacttgccaagtccttgaacgtaaactgtaccggctgcgaccaagca
ccccaagcactctgcttcctccagtctttctggaacggtaagtatattgtttctaatatc
aacgtcgacaacggacgttccggacttgatggaaactctatcctcggctctatcaacaac
tttgacatcaacgctacctgcagcgacgaaaccttccagccctgtaacagcaagtctctt
gcaaacttcaaggccctcatcgataccttccgcgatgcctacactattaataaaggtatt
cccaaggacaagggtgttgcggtaggacggtacaccgaggatacctaccaaggcggccac
ccatggtatcttattacgacagccgctgccgagtttctctacgacgcagtcgcccaatgg
aaagctcgacaagtcctttacgtcgacgctacctctcttgctttcttccaggacctttac
ccagcagtcaccgtccgccaatacaacagcggtgacgccaactcccccttcgcccagatc
atggacgctgtcaccgcctacgccgaatccttcgtcgccgtggtccagcaatacactcct
gccgacggatcactcgccgagcagttcaatcgtgacagtggcgtccctctttcagctgca
gacttgacttggtcctacgccgccttcgtcaccatggctgaacgtcgtgcgggcgagtac
ccaccgtcttggaacacccgccacgtcgctcctgtccccacagcctgtgctggtacttcc
accccaggcgtctacgtcccagccaccgcggcaggcgcgccaaacgtgacgacaggctgc
cagatcaacgtccagttcaacgtcaacgcatccacctacttcggcgagaacctctacgtc
tccggatcatccaccgatctcggcgcctgggatctgggcaacgcgatcccgatgggcgcg
ggcgggtacacgagcgagagaccgctgtggagcgtcagcacgtatctccccgccgggcag
acggtggacttcaagtatgtgagggagcagaactgcaaccaggcgcccattttcgagagc
caggaccggacgctggtggtccccgcttgcggcagtgcggctgtggtgacggatgatgcg
tgggtggggcccgtgggcacgtctgggaactgcagctga

DBGET integrated database retrieval system