KEGG   Marssonina brunnea: MBM_06245Help
Entry
MBM_06245         CDS       T03105                                 

Definition
(RefSeq) c6 zinc finger domain containing protein
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mbe  Marssonina brunnea
Pathway
mbe00220  Arginine biosynthesis
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01210  2-Oxocarboxylic acid metabolism
mbe01230  Biosynthesis of amino acids
Module
mbe_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MBM_06245
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     MBM_06245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 18762180
NCBI-ProteinID: XP_007294134
UniProt: K1WT69
LinkDB All DBs
Position
Unknown
AA seq 384 aa AA seqDB search
MQLLTASRLLLLASWAVTALSIDGQEPLQSDSGSPSIESSSTKALLKLHKDLITHASISG
AEESVGKYLTKYLESKRFTVEVQEVQSNPPRANIFAYVGKTRKTRTLVSSHIDTVPPFWK
YERRGDEIWGRGSVDAKGSVASQILAVEDLLASGSIAEGDVGLLYVVGEEVGGEGMRKAN
DLGLTWDTVIFGEPTELKLASGHKGTMGLQISAKGKAGHSGYPELGKSANAMLIPALHAL
LSLELPSSEKYGNTTLNIGRMEGGVAGNVIAEDASADILLRIADGSLEDIQKVILETMEE
LGQELDVRFTGGYGPVYIDSDVPGFQTIVVNYGTDIPHLKGDHKKYLYGPGTIMMAHSDH
EHLKVSDLENAVKGYKALIEHSLK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttctcacagcttcaagattgcttctccttgcgagctgggccgtgacagccctc
tcaatcgatgggcaggaacctctccagtcggactccggttctccatccatcgaaagctcc
tccaccaaagctctcctcaagctgcacaaagaccttatcacccacgcatcgattagtggt
gccgaggagtctgtcggaaaatacctcaccaaataccttgagagcaagagattcaccgtc
gaagttcaggaagtgcaatccaacccacctcgcgccaacatctttgcgtacgtgggcaag
acgcgcaagacgcgcaccctcgtctcctcgcacatcgataccgtcccgccgttctggaaa
tacgagcgcagaggcgacgagatctggggtcgggggagcgtagatgccaaaggcagcgtt
gcgtcgcagatcctcgccgtcgaggacctgcttgcctctggcagcattgcagaaggcgat
gtcggattactctacgtggttggcgaggaggtcggcggcgaggggatgcgcaaggcgaac
gatctgggcttgacatgggataccgttatctttggggagccgaccgagctgaagcttgcg
agcgggcataaggggacgatggggctgcagattagtgcgaagggcaaagcaggacactct
ggatatcctgaattgggcaagagtgctaatgcgatgttgatcccggcgttgcatgcgttg
ctgagtttggagctgccatcgagtgagaagtacgggaatactactcttaacattggacgt
atggaaggaggtgtggcgggcaatgttattgccgaggatgccagcgctgatattttgttg
cgcattgcggatgggagtttggaggatattcaaaaggtaattctcgagacgatggaggag
ttagggcaggagctggatgtcaggttcacgggaggttatggaccggtttatattgatagt
gatgttcctggttttcagactattgtggtgaactacggcacggatatcccacacttgaag
ggggaccataagaagtatctctatggcccaggcacgatcatgatggctcacagcgatcat
gagcacttgaaggtgtcggacctagagaatgctgtaaagggctacaaggctttgatcgag
cactcgctgaagtaa

DBGET integrated database retrieval system