KEGG   Marssonina brunnea: MBM_06802Help
Entry
MBM_06802         CDS       T03105                                 

Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mbe  Marssonina brunnea
Pathway
mbe03030  DNA replication
mbe03410  Base excision repair
mbe03420  Nucleotide excision repair
mbe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MBM_06802
   03410 Base excision repair
    MBM_06802
   03420 Nucleotide excision repair
    MBM_06802
   03430 Mismatch repair
    MBM_06802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mbe03032]
    MBM_06802
   03400 DNA repair and recombination proteins [BR:mbe03400]
    MBM_06802
Enzymes [BR:mbe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MBM_06802
    6.5.1.6  DNA ligase (ATP or NAD+)
     MBM_06802
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MBM_06802
DNA replication proteins [BR:mbe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MBM_06802
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MBM_06802
DNA repair and recombination proteins [BR:mbe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MBM_06802
   NER (nucleotide excision repair)
    Other NER factors
     MBM_06802
   MMR (mismatch excision repair)
    Other MMR factors
     MBM_06802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 18762737
NCBI-ProteinID: XP_007294691
UniProt: K1WPX3
LinkDB All DBs
Position
Unknown
AA seq 897 aa AA seqDB search
MAPPAKKRKVNNDFKSSPASSRNLDFFFGKQKEGPVVPKAETACQKPEEQGNSSNLTDEQ
LARKLQAEWDQEEAAGRRIPKEQSENGKEIGMEDVPGNYTERAETSGLGGQDEATPDQTD
ETKSVEEEAKLEDHSTRAKPVNHLLMPKGKNTLSLQAAGSAEDTISSNIPFDESPLTFDP
SKYVAELQGHWAAEGGDASYALLTRCFVLVNSTQSRIRIVDTLVNLLRVIIEGDPSSLLP
TVWLSTNAISPPYISLELGLGGSAISKALKNVCGLDSRSLKALYDKVGDAGDVAFEAKKR
QSFTLRKPKPLTIKGVYQSLVKIAKTQGTGSGEIKQRVVDRLLQDARGAEESRYVVRTLC
QHLRIGAVKTTMLIALSRALLLSRPSGADFPLKSPAELARLKKEELAVVWSNAEEIVKAC
FARRPNYNDLIPVLLEIGVCEELLIRCGLALHIPLRPMLGSITRDLSEMLTKLQGRDFSC
EYKYDGQRAQVHCDDQGRVSIFSRHLELMTDKYPDLVALIPEIRGEDVSSFIMEGEVVAV
DPESGDLKTFQTLANRARKDVAIGSVRVNVCLFSFDLMYLNGESLLDRPFRERRELLRGL
FTEIPNQFTWVRSIDATSQDSEAVLEFFKSATDVKCEGIMVKILDNLPDANIPEPSSLTA
VPVPVPVPVPEEAAPKPVRGKKNAAASEEKAEKKTRRKALLATYEPDKRLDSWLKVKKDY
STTFDTLDLIPVAAWHGQGRKSKWWSPILLAVRNEETGSLEAVCKCISGFTDAFYRANRA
FYDEAGENVVVGGKPSYLEYEGGHPDVWFEPKEVWEMAFADITISPTYTAAIGLVSDEKG
LSLRFPRFLRKREDKSIDEASTSEFLAGLWRKQEERAPVAAKEGRGHGGEDGDEDGE
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggcccctccagcgaagaaacgcaaagtcaacaacgactttaagtcatcgcctgcgagc
tcacgaaaccttgacttcttctttggaaagcagaaagaaggtcctgtcgtacctaaagcc
gagaccgcatgccagaagcccgaggagcaaggcaactcatcaaacttgacagatgaacag
ttggccaggaaattgcaggcagaatgggaccaggaagaagccgcaggtagacgaataccc
aaagaacagagtgagaatggcaaagaaattggaatggaagatgtgccgggcaactataca
gagagagcagagacatcagggcttggaggacaggatgaagccacccccgaccaaacggac
gaaacaaagtctgtggaggaagaagccaagctcgaagatcactctacaagggccaaacct
gtgaatcatctcttgatgccgaaaggcaagaatacactgtctctacaggcagccgggtca
gccgaggataccatttcctcgaatataccattcgacgaaagtcctctgacattcgaccct
tcaaaatacgttgcggaattgcaagggcattgggcagcagagggaggagatgcttcttat
gctttgcttacgagatgttttgtgttggttaatagtactcagagtcgaatcaggattgta
gatacgcttgtgaaccttctgagagtgattattgagggtgatccaagtagtcttcttcct
actgtctggctcagtacaaatgccatatcaccaccctacatatctctagaactcgggctc
ggtggttccgctatatccaaagccctcaagaatgtgtgtggtctagacagcagatcgctt
aaagctctatatgataaagttggcgacgctggcgatgtggcattcgaagcaaagaagcgg
caaagtttcacacttcgaaagccgaaacccctgaccattaaaggagtctaccaatccctc
gtcaagattgcaaagactcagggcaccgggagtggcgagatcaagcagcgggtggttgac
cgattgttgcaagatgctagaggcgcagaagagagccgatatgtcgttcggactctctgt
caacatcttcgcatcggtgccgtcaaaaccacaatgttaatagcgctctcgcgagcatta
cttctctcgcgaccatcaggagcagacttccctctcaaatctccagccgagctcgccaga
ctcaagaaggaagaattggcagtcgtctggtccaatgcagaagaaatagtaaaagcctgc
tttgccagacgaccaaattacaacgacttgatacccgtcctccttgagattggcgtctgc
gaagagctactgatcagatgtggacttgccctacacatccctctccgcccaatgctagga
agcatcacgcgagatctctccgagatgctcacgaaacttcaaggacgagatttcagctgc
gagtacaagtacgacggtcagcgagcccaagtccactgcgatgaccaaggcagggtctcc
atcttctctcggcacctcgagctcatgacagacaaatatcccgacctcgtcgccctcatc
cccgagatccgcggcgaagacgtctcaagcttcatcatggagggagaagttgtagccgta
gaccccgaatccggcgacctcaagaccttccagaccctagccaaccgcgcacgtaaagac
gtcgccattggcagcgtcagggtcaacgtctgtctcttctccttcgacctcatgtatctc
aacggcgaatccctcctcgaccgccccttccgcgaacgacgagaactcctccgaggcctc
ttcaccgaaatccccaaccagttcacgtgggtgcgatccatcgacgccacgtcccaagac
tccgaagccgttctcgagttcttcaagagcgccacggacgtgaaatgcgaaggcatcatg
gtcaagatcctcgacaacctccccgatgccaatatcccagaaccatcatccctcacggca
gtcccagtcccagtcccagtcccagtcccagaagaagctgccccgaagcccgtgagaggc
aagaagaacgcagcagccagcgaggagaaagccgagaagaagacccgccgcaaggccctg
ctcgccacctacgagccggacaagcgcctcgactcctggctcaaggtcaagaaggactac
agcaccaccttcgacacgctggacctcatccccgtcgccgcgtggcacggccagggccgg
aaatcgaaatggtggtccccgatcctcctggccgtgcggaacgaggagacgggcagtctg
gaggccgtgtgcaaatgcatcagcggcttcaccgacgccttctacagagcgaaccgggcc
ttctacgacgaggccggggagaatgtggtggtgggtgggaagccgagttaccttgagtac
gagggcggacacccggatgtgtggttcgagccgaaggaggtctgggagatggctttcgct
gacatcacgatcagtccgacctataccgcggcgatcggcctcgtgagcgacgagaagggc
ctgagtctccgcttcccccgctttctgaggaagagagaggataagagtatcgacgaagcg
agcacaagcgagtttctcgccgggctctggaggaagcaggaggagagggcgccggtcgct
gctaaggagggacgggggcacggtggggaagacggggacgaggacggggagtga

DBGET integrated database retrieval system