KEGG   Marssonina brunnea: MBM_07306Help
Entry
MBM_07306         CDS       T03105                                 

Definition
(RefSeq) sorbitol dehydrogenase
Organism
mbe  Marssonina brunnea
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C FAD_binding_3 ADH_N_assoc Pyr_redox_2 NAD_binding_7 TrkA_N
Motif
Other DBs
NCBI-GeneID: 18763241
NCBI-ProteinID: XP_007295195
UniProt: K1WB92
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MPAEPVEYNFKQAFAAGPADTMRALRFHGQRDIRLDQVPVPVCGRGQVKIRPAFVGICGT
DLHEYLGGASLIPSAHPHPITGEKVPLTIGHEFSGTVVEVGEGVTSHRVGDRVCVQPIIF
DGTCGACLEGYINCCYSNGFIGLSGCGGGLSDFTVCPATSAIPLPPTISLEVGALIEPLA
VAWHAVKTSPFRAGDDVLVIGGGPIGLAVIQVLRCKGAGQIIVSEVSPQRKRFAAAFGAH
HVLDPTDVDVVTEVRRLCSAGHGHGQGQGVHVAFDAAGVQSGLQAAIESLRARGTLVNIA
VWEKPTPIFPNDFVFKERRYMGVATFVAGEFAEVLDAIVAGTIQPSKMITKTVPLADAVT
EGYDSLIHDKDNHVKILVEVHGEVG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgagcccgtggagtataacttcaagcaggcctttgcagctgggcccgcggac
acgatgcgcgcgctgcgcttccacggccagagagatatccggctcgatcaggttccggtc
ccggtgtgtgggagagggcaggtcaagatccggcctgcgtttgtggggatctgtgggact
gatctgcacgagtacttgggaggagcgagcttgataccatcggcgcatccgcacccgatt
acaggcgagaaggtgccgttgacgatcggccacgagttcagcgggaccgtggtggaagtc
ggcgagggagtgacaagccatcgcgtcggcgatcgcgtgtgcgtacagcccatcatcttc
gacgggacatgcggtgcctgtttggaaggctacatcaactgctgctatagcaacggcttc
atcgggctcagcggttgcggaggcggcctatccgacttcacagtctgtcccgccaccagc
gccatccccctcccgcccaccatcagcctcgaagtcggcgctctcatcgagcccctcgcc
gtcgcctggcacgccgtcaagacctcccccttccgcgccggcgatgacgtcctcgtgatc
ggcggcggccccatcggtctcgccgtcatccaggtcctgcgctgcaagggtgccggccag
atcatcgtctcggaggtctcgccccagcggaagcgcttcgcggccgccttcggcgcccac
cacgtcctggacccgactgacgtcgacgtcgtgaccgaggtccgtaggctgtgcagcgcc
ggccacggccacggccagggccagggggtgcacgtcgccttcgacgccgcgggcgtgcag
agcggcttgcaggcggccatcgagtcgctccgggcgcgcggcacgctcgtcaacatcgcc
gtgtgggagaagccgacgccgatcttcccgaacgactttgtgtttaaagagcggaggtat
atgggcgtcgcaacatttgtggcgggggagtttgcggaggtgttggatgcgattgttgct
ggaaccatccagccctccaagatgatcacaaagaccgtccccctagccgacgccgtaacg
gagggatacgacagcctgatccacgataaggataaccacgtcaagatcctggtcgaggta
catggagaggttggctag

DBGET integrated database retrieval system