KEGG   Marssonina brunnea: MBM_07906Help
Entry
MBM_07906         CDS       T03105                                 

Definition
(RefSeq) isocitrate dehydrogenase NADP
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mbe  Marssonina brunnea
Pathway
mbe00020  Citrate cycle (TCA cycle)
mbe00480  Glutathione metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01200  Carbon metabolism
mbe01210  2-Oxocarboxylic acid metabolism
mbe01230  Biosynthesis of amino acids
mbe04146  Peroxisome
Module
mbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MBM_07906
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MBM_07906
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MBM_07906
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MBM_07906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18763841
NCBI-ProteinID: XP_007295795
UniProt: K1W928
LinkDB All DBs
Position
Unknown
AA seq 455 aa AA seqDB search
MSVSRTVLTRTLCNLTRPQQSSHTSAFFTPVRFGGALIQARNMASFPKIKVKNPVVELDG
DEMTRIIWKDIKDKFIYPYLDIDLKYYDLGLEYRDETNDQVTIDSAEAIKKYSVGVKCAT
ITPDEARVKEFNLKKMWLSPNGTIRNSLGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAF
GDQYRAKDRVIPGNGTLKMVFTPEGGKPEEIEVYQFKNGGGVAQTQYNTDESIEGFAHAS
FKLAISKSLPLYMSTKNTILKKYDGRFKDIFEEIYQSTYKKEFEEKKIWYEHRLIDDMVA
QMMKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHY
REHQKGKETSTNPIASIFAWTRGLIQRGKLDGTPDVVAFAESLEQACIDTVDVDGIMTKD
LALACGKTSRDDYVTTTEYMNAVERRMKSLLKQKL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctcaagaaccgtcctcacacgcactctgtgtaacctcacaagaccacaacag
tcctcacacacctcagccttctttacacccgtaagattcggcggagccctcatacaagcg
cgcaacatggcctccttccctaagatcaaggtcaagaacccggtggtggagctggacggc
gacgaaatgacccggatcatctggaaggacataaaggacaagttcatctacccgtacctg
gacatcgacttgaagtactacgacttgggactggaatacagagacgagacgaacgaccag
gtcaccattgattctgcggaggcaattaagaagtactcggtcggtgtcaagtgcgcaacc
atcacgccagacgaggcccgggtcaaggaatttaacctcaagaagatgtggctttctccc
aacggaactattcgaaattccctcggcggcacagttttcagggaaccgatcgtcatcccc
cgcatcccccgcctcgtgcccggctggaaaaaacctattatcatcggccgccacgccttc
ggtgaccaataccgcgcaaaagaccgggtcatcccaggaaatggtactctcaaaatggtc
ttcacgcccgagggtggtaagcccgaggaaatcgaggtctaccagttcaagaatggtggc
ggggtagcgcaaacacaatacaacactgacgagtctatcgagggtttcgcacacgccagt
ttcaagcttgcgatctcgaagagcttgccgctgtatatgagcaccaagaacacgatcttg
aagaagtacgacggacgcttcaaggacatcttcgaggagatctatcagtcgacgtacaag
aaggaattcgaggagaagaagatctggtacgagcatagacttattgacgatatggttgcg
cagatgatgaagagttcgggggggtacattatggctctgaagaattacgatggagacgtc
caatccgacattgttgctcaaggcttcggctcgcttggtctcatgacctccgtcctcatc
accccagacggcaaaaccttcgagtcggaagccgcccatggcaccgtcactcgccactac
cgcgagcaccaaaagggcaaagagacatccaccaaccccatcgcctccatattcgcttgg
acccgtggtctcattcagcgcggaaagttggacggcacacccgatgtcgtggcgttcgcg
gagagtctagagcaggcatgtatcgacacagtcgatgttgatggtatcatgacgaaggat
ttggcactggcgtgcggcaagaccagtcgcgatgattacgtgacgacgacagagtacatg
aatgcagtggaaaggaggatgaagagcttgctgaagcagaagctgtag

DBGET integrated database retrieval system