KEGG   Marssonina brunnea: MBM_09194Help
Entry
MBM_09194         CDS       T03105                                 

Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
mbe  Marssonina brunnea
Pathway
mbe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01230  Biosynthesis of amino acids
Module
mbe_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MBM_09194
Enzymes [BR:mbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     MBM_09194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 18765129
NCBI-ProteinID: XP_007297083
UniProt: K1W6M1
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MASVNGTTKSADLDSAPAWSPSSWTSKPIKQEAVYEDMKNVEKSLAKLERLPPIVTPTEI
EKLKASLRDVALGKAFLLQGGDCAELFDYCEENAIESKIKLLLQMSLVLIWGSNKPVVRI
ARMAGQYAKPRSSPTELVNGVETPSFRGDILNGFALDERSLDPARLVSAYFHSATTLNFM
RGSIASGIADLHRPLDWGLGHVRDPELQAKYSSIVSSITDSLRFMRTVGADTAGQLQTVD
LFTSHEGLLLDYEQRLTRLLNNPTKTSSRANSVSDDTKSYYNTSAHFLWVGDRTRQIDGA
HIEYFRGIANPIGVKIGPTTSSSDLLTLLRTLNPAIEVGKITLITRYGASKVRSLLPTHI
KTVEGSEYARSVVWQCDPMHGNTRSTSTGIKTRQFADILSELQETIAVHKEEGSYLGGVH
LELTGEAVTECTGGSEGLNEDDLSLNYTSFCDPRLNEKQALELAFLIAGHQRGEVALA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtcaatggcactaccaagtccgctgacttggactccgcgccagcgtggtct
ccaagctcttggacctcgaaaccaatcaagcaagaagccgtctatgaagacatgaagaac
gtagagaagtcacttgcaaagctggagcgtctcccgcccattgtcactcccacagaaata
gagaaactcaaggcaagtcttcgcgatgtcgctctaggtaaggccttcctcctccaaggt
ggagactgtgcagagctcttcgactactgcgaggagaatgccattgagtcgaagatcaag
ctgctgctgcagatgagcttggtcttgatttggggatctaataagccggtcgtccgcatt
gctcgtatggctgggcagtatgcaaagcctcgatccagtcctactgagcttgtcaacggc
gtcgagactccttcattcagaggagatatcttgaatggcttcgctctagatgagcgatct
ctcgatccagctcgtcttgtcagtgcctacttccactctgcaacaactctcaacttcatg
cgtgggtctattgcatccggaatcgcagatctgcaccgtcctctcgactggggacttgga
cacgttcgtgatccagagctacaggctaaatactcctccatcgtctcctccatcacggac
tccctccgcttcatgcgcacagttggagcagacacggcaggccaacttcaaaccgtcgac
ctcttcacttctcatgaaggtctcctactcgactacgagcaacgtctaactcgtctcctc
aacaatcctacgaaaacctcatcacgtgcaaactctgtctcagacgacaccaaatcctac
tacaacacttccgcacattttctctgggtcggtgaccgtacaagacagatagatggcgct
catattgaatacttccgtggcattgcaaaccctataggtgtcaagataggtcccacaact
tcctcttccgacctccttaccctcctccgcacgctcaaccctgctattgaagttggcaag
atcacactcatcacacgctacggcgcgtccaaagttcgatcccttcttcctacacacatt
aagacagttgaaggtagcgagtatgcccgcagcgtggtctggcagtgcgatcccatgcac
ggcaacacaagatccacttctacaggcattaagacacgacaattcgctgatatcctttcg
gagcttcaagagactatcgcagtccacaaagaagaaggtagctatcttggtggagttcat
cttgagctcactggcgaggccgtcactgagtgcactggcggtagcgaaggcttaaacgag
gacgacctgtctctcaactacaccagtttctgcgacccaagattgaacgagaagcaagct
cttgaacttgcatttctgattgcaggtcatcaacgtggggaagtggctctggcgtag

DBGET integrated database retrieval system