KEGG   Marssonina brunnea: MBM_09896Help
Entry
MBM_09896         CDS       T03105                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mbe  Marssonina brunnea
Pathway
mbe00010  Glycolysis / Gluconeogenesis
mbe00051  Fructose and mannose metabolism
mbe00052  Galactose metabolism
mbe00500  Starch and sucrose metabolism
mbe00520  Amino sugar and nucleotide sugar metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01200  Carbon metabolism
Module
mbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mbe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBM_09896
   00051 Fructose and mannose metabolism
    MBM_09896
   00052 Galactose metabolism
    MBM_09896
   00500 Starch and sucrose metabolism
    MBM_09896
   00520 Amino sugar and nucleotide sugar metabolism
    MBM_09896
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MBM_09896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mbe04131]
    MBM_09896
Enzymes [BR:mbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MBM_09896
Membrane trafficking [BR:mbe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MBM_09896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 18765831
NCBI-ProteinID: XP_007297785
UniProt: K1WGD3
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MVGLGPRFIGSMADVPKDLLQEIKRLEDLFTVPKAKLKEITDHFVNELTKGLTVEGGSIP
MNPTWCMAFPDGHEKGTFLALDMGGTNLRVCEIILTDEQGEFDIIQSKYRMPEELKTGHA
EELWEYIADCLQQFIEHHHGNEKVGSLPLGFTFSYPATQDYVDHGVLQRWTKGFDIDGVE
GENVVPMFEAAIAKRGVPIRLTALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYMENC
GSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDVIVDKESPRPGQQAFEKMIAG
LYLGELFRLALVDLHDNKEVHIFEGQNIDKLRKAYTLDSSFLSAIEEDPFENLQETGDLF
ANRLSITATRPELELVRRLAELIGTRAARLSACGVAAISKKKGYDSCHVGADGSVFNKYP
HFKQRGAAALREILDWAPKKSSKDEDPIEILAAEDGSGVGAALIAALTLKRVKEGNMAGI
LHPENFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtaggacttgggcctcgttttataggatccatggccgatgtgccaaaggatcttttg
caggagattaagagactggaagatctgttcaccgttccaaaggccaagctgaaagagatc
accgatcacttcgttaatgagctcaccaaaggtcttaccgttgagggtggaagcatcccc
atgaacccaacatggtgtatggcattcccagatggacacgagaagggcaccttccttgct
ctagatatgggcggaaccaaccttcgtgtttgcgagatcatcttgaccgacgagcaaggt
gaatttgacatcatccagagcaagtaccgcatgcccgaggagctcaaaactgggcacgct
gaagaactgtgggagtacattgcggattgccttcaacaatttattgagcaccaccatgga
aatgagaaagtgggtagccttcctctcgggtttaccttctcttaccccgccacccaagac
tacgtagaccatggagttttgcaacgttggaccaagggcttcgacatcgacggagttgaa
ggagaaaacgtcgtgcccatgttcgaggcggccattgctaagcgaggcgtgcctatcaga
ctcacagctctgatcaacgacaccaccggaaccctgattgcctcggcatacaccgacacc
aagatgaagatcggttgcatcttcggcaccggctgcaacgcggcttacatggaaaattgc
ggctccatccccaagctcgcccacatgaacctgcctcccgacacgccaatggccatcaac
tgcgaatggggtgccttcgataacgagcacaaagtcctcccccgtaccccctacgacgta
atcgtcgacaaggagtccccccgtcccggacaacaagccttcgagaagatgattgccggc
ttgtacctcggcgagctcttccgtcttgctctggtcgacctccacgacaacaaggaagtc
cacatcttcgaaggtcagaacatcgataagctccgcaaagcttacaccttggactcctcc
ttcctctccgccatcgaagaagatcctttcgagaacctgcaagagacaggcgacctcttt
gcaaacagactcagcatcaccgccacgcgcccagagctggagctcgtccgccgcctcgca
gaactcatcggtacccgtgccgcccgcttgtccgcctgcggtgtcgcggccatctccaag
aagaaaggctacgacagctgccacgttggcgctgacgggtccgtcttcaacaagtacccg
cacttcaagcaacgtggcgccgctgccttgcgcgagattctggactgggccccgaagaag
agcagcaaggatgaagacccaattgagatcctggctgcggaggacgggagcggagttggt
gctgcattgattgcggcgttgacgctgaagcgcgtgaaggaggggaacatggcagggatt
ttgcacccggagaacttcaagtag

DBGET integrated database retrieval system