KEGG   Candidatus Melainabacteria bacterium MEL.A1: BHV42_02455Help
Entry
BHV42_02455       CDS       T04546                                 

Definition
(GenBank) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mbf  Candidatus Melainabacteria bacterium MEL.A1
Pathway
mbf00040  Pentose and glucuronate interconversions
mbf00051  Fructose and mannose metabolism
mbf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BHV42_02455
   00051 Fructose and mannose metabolism
    BHV42_02455
Enzymes [BR:mbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BHV42_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C ADH_zinc_N_2 adh_short adh_short_C2 Topo_C_assoc F420_oxidored AdoHcyase_NAD 3HCDH_N ADH_N_assoc Fam20C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AOR38126
UniProt: A0A1D7YRF7
LinkDB All DBs
Position
complement(526068..527111)
Genome map
AA seq 347 aa AA seqDB search
MKAIQYYGPQNIKYEEVMVKPPEEGEVVVKVMSALTCGTDVKTFRRGHPVLIKSVPSGFG
HEFAGIVDRVGKGVENVKVGDRVVAANSAPCGKCFYCRHEEYNLCENLDLLNGAYAEYIT
VPARIVKKNMLILPDNLSFDKAAFCEPLANVVHGVERTDIKAGQTVGIIGIGPIGLMFAR
LAKLKGARVIVAGRNPIKLKAAEEFAHADEIVDLTKYPNPEKIFREYTEEHKGLDVAVEC
VGLPEIWERIFSCVRPGGTVHFFGGCKSGSTVTFDTTKMHYGDIKLMSVFHHTPKYFRMA
LDYIASGDVEVEKLITDTLPLDKVEWAMHQHIEGKAIKFLIKPELHS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattcaatattacggaccacaaaatattaaatatgaagaagttatggtaaaa
ccgccggaagaaggcgaagttgttgtaaaagttatgtcagctttgacttgcggtactgat
gtaaaaacatttaggcgtggacatccggttttgataaaatctgtaccatcaggttttggt
cacgagtttgccggaattgttgatagagttggaaaaggtgtcgaaaatgtaaaagttggt
gatagagtagttgctgccaactctgctccttgtggaaaatgtttttattgcaggcatgaa
gaatataatttgtgcgaaaatctagacttgttaaacggtgcttatgcagaatatattaca
gttccggctcgaattgttaaaaagaatatgttgattttgccagacaatttgagttttgat
aaagccgctttttgtgaacctttggcaaatgttgttcacggtgttgaaagaactgatata
aaagcaggtcaaaccgttggcattattgggattggacctattggtttgatgtttgcaaga
ttagcaaaattaaaaggtgcaagggttattgtcgctggaagaaatccaataaaattgaag
gctgcagaagaatttgcgcatgcagatgaaattgttgatttaacgaaataccctaaccct
gaaaagattttcagagaatatacggaagaacataaaggtttggatgtagctgttgagtgt
gttggtttacctgaaatttgggagagaattttctcctgtgttagacctggaggaaccgtt
catttctttggcggttgtaaatctggctctacagtgacttttgatactaccaagatgcac
tatggcgatataaaattgatgagtgttttccatcatactccaaaatatttcagaatggct
ttggattatatcgcatccggagatgtagaggtagaaaaacttataactgataccttgccg
ttagataaagtagaatgggcaatgcaccaacacattgagggaaaagcaattaagttttta
attaaaccggaattgcatagctaa

DBGET integrated database retrieval system