KEGG   Candidatus Melainabacteria bacterium MEL.A1: BHV42_08385Help
Entry
BHV42_08385       CDS       T04546                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mbf  Candidatus Melainabacteria bacterium MEL.A1
Pathway
mbf00473  D-Alanine metabolism
mbf00550  Peptidoglycan biosynthesis
mbf01100  Metabolic pathways
mbf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mbf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BHV42_08385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BHV42_08385
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BHV42_08385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mbf01011]
    BHV42_08385
Enzymes [BR:mbf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BHV42_08385
Peptidoglycan biosynthesis and degradation proteins [BR:mbf01011]
 Precursor biosynthesis
  Amino acid ligase
   BHV42_08385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATP-grasp GARS_A RimK ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AOR39233
UniProt: A0A1D7YUK7
LinkDB All DBs
Position
1699293..1700243
Genome map
AA seq 316 aa AA seqDB search
MQDIVSKVDKNAKIAVLCGGMSSEAEVSMRSGKGCYDALQRLGYKNAELVVVDKDIANKL
KVGNYDYAFNALHGKYGEDGCIQGILEILQIPYTGCGVMASSVCMNKEYTKRILSTCKDI
PLIKSVFVQKGDDVVEKTKDLKYPLITKPVCEGSSFGMTKVNTPDELEKAYHDAVQYNDD
VLIEEYLVGKAATVGVLGDGADRTVTEILEMRPKHEWYDYECKYTKGMTEFVLPAEISED
MTKRVKEIALKAFEVAGCSGVSRVDFHIVGDIPYVLEINTSPGMTETSDLPAQAAVMGID
YDSLVQIILNSVGLNK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatattgtatcaaaagtagataaaaatgcgaaaatagctgtgctttgtggtggg
atgtcatctgaggcagaggtttcaatgagatctggtaaaggttgctatgatgctttgcaa
agattaggttataaaaatgctgaattggttgttgttgataaagatatagccaacaaatta
aaagtaggaaattatgactacgcattcaatgctttgcacggaaaatacggtgaagatggt
tgtattcaaggaattttagaaatcttgcaaatcccttatacaggttgcggagttatggca
agttctgtttgtatgaacaaagaatatacaaaaagaatactttcaacatgcaaggacatt
ccattgattaaatctgtttttgtccaaaaaggtgatgatgtggttgaaaagactaaggat
ttgaaatatccgttgattacaaaaccagtttgtgaaggttcaagttttggtatgacaaag
gttaatactcctgatgaattggaaaaagcttatcacgatgcggttcaatataatgacgat
gttttgattgaagaatatcttgtagggaaagcagcaactgttggagttttgggtgatggt
gcagataggactgttaccgaaattttagaaatgcgcccaaaacatgaatggtatgattac
gaatgtaaatatacaaaagggatgacagagtttgttttacctgccgaaatttcagaagat
atgacaaaaagagttaaagagattgctttaaaagcttttgaagttgcaggttgttctggc
gtttcaagggttgatttccatattgttggcgatattccttatgtgttagaaattaataca
agtcccggaatgactgaaacaagtgatttgccggctcaagcagcggttatggggattgat
tatgacagtttggtacaaataatcttaaacagtgtaggtttaaataagtag

DBGET integrated database retrieval system