KEGG   Methanoculleus bourgensis: BN140_0092Help
Entry
BN140_0092        CDS       T02189                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mbg  Methanoculleus bourgensis
Brite
KEGG Orthology (KO) [BR:mbg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN140_0092
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN140_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox FAD_oxidored GIDA FAD_binding_2 HI0933_like Thi4 DAO Lycopene_cycl NAD_binding_8 NAD_binding_9 GST_N_3 FAD_binding_3 Trp_halogenase AlaDh_PNT_C Thioredoxin_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 13353491
NCBI-ProteinID: CCJ35015
UniProt: I7KX93
LinkDB All DBs
Position
87555..88736
Genome map
AA seq 393 aa AA seqDB search
MAGVKVYTTENCPYCRMVIAFLEKYGVEYETVDVGRDREAAREMITVSGQRGVPVTIFGD
AVIVGFDAKRLRELFGKPVTDGVYDVVIVGAGPAGLTAAVYCARKLMKTVIISENIGGQA
TWSWAIENYMGFRMITGEDLIRKFEEQVRGLDVNLELDSVQSVQKEGDIFLVRTAPGNTY
RCRTVILTPGKHPRTLGLPDEDRLMGRGVSVCSTCDGPLFRARPVAVVGGGNAAIQTAIE
MARIASSVALVVRSTLKCDEIYVDRAKEMGVQIFLHSEVSALHGEATLTGITVRDRETGK
ATVLNVEGLFLEIGLVPNTGFLKDLVALNDLGEIIVDENNHTSVPGVFAAGDATCIRGKQ
IIIAAGEGAKAALAAHEHLLKEGLSRAPTPAAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgtgaaggtctacacgacagagaactgcccctactgccggatggtcattgcg
ttccttgagaagtacggggtcgaatacgagaccgtcgatgtcgggagagaccgcgaggcg
gcccgggagatgataacggtctcggggcagcggggcgtgccggtcacgatctttggcgat
gcggtgatcgtcgggttcgacgcgaagcggctccgggaactcttcgggaagccggtgact
gacggggtctacgacgtggtcatcgtgggcgccgggccggccgggctgacggccgcggtc
tactgtgcgcgaaagctcatgaagaccgtcatcatatctgagaatatcggcggccaggcg
acctggagctgggcgatcgagaattatatgggctttcggatgatcacgggcgaggacctg
atcaggaagttcgaggagcaggtcagggggcttgacgtcaaccttgaactggatagcgtc
cagagtgtccagaaagagggcgatatcttccttgtccggacagcccccgggaacacctac
cgctgccggacggtcatcctcacccccgggaagcacccccggaccctggggctccccgac
gaggaccggctgatggggaggggcgtctcggtctgctcgacctgtgacggcccgctcttc
cgcgcacgaccggtcgccgtcgtcggcggggggaacgcggcgatccagaccgcgatcgag
atggcaaggatcgcgagttccgtggccctggtcgtcaggagcaccctcaagtgcgacgag
atctacgtcgaccgggcaaaggagatgggtgtgcagatattcctccacagcgaagtttcg
gcgctccacggcgaggcgaccctgaccgggatcacggtcagggaccgcgagactgggaag
gcgacggtcctcaacgtggaggggctcttcctcgagatcgggcttgtgccgaatacaggg
ttccttaaggatctggtggcgttaaacgatctgggagagatcatcgtcgacgagaacaac
cacacgagtgtccccggggtctttgcggccggggatgcgacctgcatcaggggcaagcag
atcatcatcgctgccggcgagggggcgaaggctgcgcttgcggcgcatgagcacctcctg
aaggaggggctctcccgcgcccccacaccagcggccttatga

DBGET integrated database retrieval system