KEGG   Methanoculleus bourgensis: BN140_1075Help
Entry
BN140_1075        CDS       T02189                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K13812  bifunctional enzyme Fae/Hps [EC:4.2.1.147 4.1.2.43]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00030  Pentose phosphate pathway
mbg00680  Methane metabolism
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01200  Carbon metabolism
mbg01230  Biosynthesis of amino acids
Module
mbg_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN140_1075
  09102 Energy metabolism
   00680 Methane metabolism
    BN140_1075
Enzymes [BR:mbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BN140_1075
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.147  5,6,7,8-tetrahydromethanopterin hydro-lyase
     BN140_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fae OMPdecase Ribul_P_3_epim FMN_dh QRPTase_C Fer4_23
Motif
Other DBs
NCBI-GeneID: 13355175
NCBI-ProteinID: CCJ35998
UniProt: I7J8C5
LinkDB All DBs
Position
complement(1107724..1108905)
Genome map
AA seq 393 aa AA seqDB search
MYLIGEALVGDGAELAHIDLILGNKEGAVGQAFANSLSQLSKGHTPLLAVIRPNLPTKPS
TLVIPKVTLKKEYQVNQIFGPVQAAVAKAVADSVEEGVFEGIDIEDTVIMASVFVHPTAE
DYNKIYRFNYGAMKLALRRALDRFPDIDTLMHEKDRAAHAVMGFKVQRLWNPPYLQVAMD
LVDRNHMRRVLEELPQNDHLIIEAGTPLIKKFGLSIISEIREIRPNAFIVADLKTLDTGN
LEARMTADAGADAVVVSGLAPISTIEKAITDTRKTGIYTVVDMLNVEDPAAVVEQLAVKP
DVVELHRGIDVEDTDYAWGDIPAIKKAGGERLLVATAGGVRLPVVKDALHAGADILVVGR
AITGSKNIKNAAEEFLLELNTEEIDQFRIMTDF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcatcggtgaagcattggttggagacggcgcagaacttgcgcacatagatctg
atattgggaaacaaagagggagcggtagggcaggcgtttgcaaactcgctctcgcagctc
tcgaagggtcacacgcccctgctcgcggtcatcaggccgaacctgccgacgaagccctcg
acgctcgtcatcccgaaggtcaccctgaagaaggagtaccaggtaaaccagatcttcggg
ccggtccaggcagcggtggccaaagccgtcgccgactcggtcgaggagggcgtctttgag
gggattgatatcgaagacactgtgatcatggcaagcgtctttgtccaccccaccgccgag
gactacaacaagatctaccggttcaactacggggcgatgaaactcgctctccgccgggct
cttgaccggttcccggacatcgatacgctcatgcacgagaaagaccgggccgcccatgcg
gtcatggggttcaaggtgcagcggctctggaacccgccgtacctgcaggttgcgatggac
ctcgtcgacaggaaccacatgcgcagggttcttgaagagctgccccagaacgaccacctg
atcatcgaggccgggacgcccctgatcaagaaattcggcctctcgatcatatccgagatc
cgtgagatccgcccgaacgccttcatcgtcgccgacctaaagacgctcgacaccgggaac
cttgaggcccggatgaccgccgacgccggcgccgacgccgtggtggtctccggtcttgcg
cccatctccaccatcgagaaggctatcaccgatacccggaagaccggcatctacacggtg
gttgatatgctcaacgtcgaagacccggccgctgtcgtcgagcagcttgcggtgaagccg
gacgtcgttgaactccaccggggcatcgatgtagaggataccgattacgcctggggagat
atcccggcgatcaagaaggcgggcggcgagcggctgctggtcgcgacggcaggcggcgtc
aggctgcccgtcgtgaaggacgcgctccacgcaggcgccgatatccttgtcgtcggccgc
gcgatcaccggaagcaagaacatcaagaacgcggcagaagagttcctcctggaactgaac
accgaagagattgaccagttcaggattatgaccgacttctag

DBGET integrated database retrieval system