KEGG   Methanoculleus bourgensis: BN140_2166Help
Entry
BN140_2166        CDS       T02189                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00630  Glyoxylate and dicarboxylate metabolism
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01200  Carbon metabolism
Module
mbg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN140_2166 (rbcL)
Enzymes [BR:mbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BN140_2166 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 13354056
NCBI-ProteinID: CCJ37089
UniProt: I7LNH2
LinkDB All DBs
Position
2261357..2262649
Genome map
AA seq 430 aa AA seqDB search
MAIDWYEEFVDTDHTPGSDELVALYYFEPAAGISREEAVGRIASESSTGTWTTLFTMPPR
MRDLQAKAFEIEGNYVKIAYPLALWEEGNAPQLLSGIAGNVFGMKALESLRLIDASLPAE
YLRHFKGPHFGMEGIRDMMKVHGRPLTGAVPKPKVGFTAEEHAEVGYETWMGGFDFVKDD
ENLTSLAFNRFEDRVRAMTKMRDRAEQETGDVKSAFINITADTETMKKRAEMLADYGWNY
AMIDVVVTGTAAVATLRDHCSDLGLAIHAHRAMHAAFDRDEKHGITMQFLAKIMRLIGVA
QIHTGTAVGKLVGTKAEATVLADMVREKHTNAVDHMALDQDWGAIKSAFPVSSGGLHPGL
VPDVLDIYGSDLVLLVSGGIHGHPKGTRAGAMATMQAIEAWSEGETLEEKAKKAPELREA
LEKWGYYKPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgactggtatgaagaatttgttgacacagaccacactcccggttcggatgag
cttgtagccctctactacttcgaacccgcggccgggatcagcagggaggaggcggtcggg
agaatcgcatccgagagctcgaccgggacctggacgacgctctttactatgcccccccgg
atgcgggacctccaggcgaaggcgtttgagatcgaagggaactatgtgaagatcgcatac
cccctcgccctctgggaggagggcaacgctccccagctcctgagcggcatcgccgggaac
gtcttcgggatgaaggcgcttgagagcctgcggctgatcgacgcctcgctcccggccgaa
tacctccggcacttcaaggggccgcacttcggcatggaggggatccgggatatgatgaag
gtccatggtcggccgctcacgggggcggtgccgaaaccgaaggtggggttcaccgcagag
gagcatgcggaggtcgggtatgagacctggatgggcgggtttgacttcgtgaaggacgac
gagaacctgacatccctcgcgttcaaccggttcgaggaccgtgtccgggccatgacgaag
atgcgtgaccgggccgagcaggagaccggcgacgtgaagtccgcgttcatcaacatcacg
gccgatacagagacgatgaagaagcgggcggagatgctcgctgactacggctggaactac
gccatgatcgatgtcgtggtgaccgggaccgccgcggtcgcgaccctccgtgaccactgc
tccgacctcgggcttgcgatccacgcccaccgggcgatgcacgcggccttcgaccgggac
gagaagcacgggatcacgatgcagttcctggcgaagatcatgcggctcatcggtgttgcg
cagatccacaccgggaccgccgtcgggaaactggtcggcacgaaggcggaggccacggtg
cttgccgatatggtccgggagaagcatacgaacgcggtggaccacatggccctcgaccag
gactggggcgcaatcaagagcgcttttcccgtctcgtcgggcgggctccaccccgggctc
gtgccggatgtcctcgatatctacggcagcgacctcgtcctcctggtgagcggcggcatc
cacggccacccgaagggcacgcgggccggcgccatggccaccatgcaggcaattgaggcc
tggagcgagggcgagaccctcgaagagaaggcgaagaaggctcccgaactcagggaagcc
ctcgagaagtggggctactataaacccaaataa

DBGET integrated database retrieval system