KEGG   Methanoculleus bourgensis: BN140_2178Help
Entry
BN140_2178        CDS       T02189                                 

Definition
(GenBank) hypothetical protein
Organism
mbg  Methanoculleus bourgensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Big_2 LRR_4 Big_9 Cadherin_4 NHL Cadherin_5 LRR_8 SGL Invasin_D3 LRR_9 PKD DUF5128 Big_1 SBBP Flg_new
Motif
Other DBs
NCBI-GeneID: 13354063
NCBI-ProteinID: CCJ37101
UniProt: I7KDQ7
LinkDB All DBs
Position
2281328..2289607
Genome map
AA seq 2759 aa AA seqDB search
MDRSRVIAGAIVILLAVAVLAVPVAAEEYVFVTKWGEYGTGEGFKDPFDIAIDTAGHIYI
TETDANHILQRILKLDSSMNFITKWGSYGTGNGQFNGPQGIAVNAAGNVYVADTYNHRIQ
KFDSSGNLLTKWGSWGSGDGQFSYPDSVAVDAAGNVYVSDTNNGRIQKFDSDGTFLGKWG
SWGSGDGQLRFSQDLVVDAAGNIYVAEYGNHRIQKFDSNGNFLWKKGSSGSGDGQFLSPY
GITVDAAGNVYVADTWNHRIQKFDSSGNFLTKWGSRGSGNGQFSEPFGVAVDSAGNVYVT
ERGNDRVQMFAPASALTVTGIVPASGLNTGSVSITDLSGTGFANGATVNLTRTGETNIVA
TDVSVLSSTQITCTLDLTGAVAGSWNVVVTNPDNQFATLTDGFTVNAENRAPVAEDDTYT
TDEDTLLTISAPGVLANDNDPDGDALTAVLVDDVSNGTLTLNADGSFTYLPNTGFSDIDT
FTYTANDGTQSSNVATVSINVNPASAVLTSIVVTPVQPILEIGGTQQFTATGYDQYGTPL
PTGEIVWSSTNTTVGTIDATGLFTATAEGSTTVTATAGEVSGTAEVTVNPALTVTGIVPA
SGPNTGNVSITNLSGTGFVDGATVNLTRTGETNIVATDVSVLSSTQITCTLDLTGAAAGS
WNVVVTNPDGRYDILSDGFAVVAASEIVTFNDPNLEATVRGALGKPVGDITADDMATFIT
LGADWRGIRDLSGLEYAVNLQHLYLQQNRQISDLGPLAGLTDLQTLDLWNNQISDLSPLA
GLTNLSVLLLGSNQISDIGPLAGLTDLQRLHLYDNQIRDIGPLAGLTNLWELRLYNNQIR
DIGPLVANSGLGSGDEVYLQYNYLDLTPGSADMNDIQTLQSRGVYVAYEPQNPVPTYTLD
LAVNPEGGGTVTGAGTYKAGDTVPITATPNEGWEFVNWTNETGATVSSEPNFDYPMPEGD
VALTANFEGEAITYTLGLAVNPAGSGTVTGAGTYAAGDTVSVTATPNDGYTFVNWTDETD
VTVSTAASFDYTMPDGDVTLTANFAAITYTLDLAVNPEGSGTATGAGTYAAGATVPITAT
PNEGWEFANWTDGTGATVSSEATFDYTMPAQETALTANFEPAPPVLARIEVSPAEATLEV
GATRQFTATGYDQYGNPLSVGEIVWSSTNEAVGTIDASGMFTALAAGSTELVAEANGISG
KANVTVTPAAPVLTSIAVTPESPALEIGTTQQFTATCYDQYGQTMPDMAVSWSSSNTSVG
TIESNGMFTALTAGSTTVTASAAGVSGQTVATVNPAAPVVTRIAVSPPSVTLDIGDTQAF
VATCYDQYENEMPGTSVSWASDSTTVGTIDATGLFTATAEGSTTVTATAGDVSGTAEVRV
NPALTVTGIVPASGPNTGPVSITDLSGTGFADGATVKLTRDGEADIVATDVAVLSPTQIT
CTLDLTGAAVGTWNVVVTNPDEQYDILSDGFAVVAASEVVTFNDPNLEAAVRQELSKPKG
DITADDMATLTRLSAAGRGIRDLSGLEYAVNLQTLYISNNQISDLSPLAGLTNLQTLWLQ
DNQVSDLSPLAGLTNLQRLWLNQNQIRDVSPLAGLTNLRELLLAVNQISDLSPLAGLTNL
GYVQLYRNQISDLSPLAGLTNLGYVQLYRNQISDLSPLAGLTNLYFLDISYNQISDLSPL
ASLTNLYFLDISYNQISDISPLAGLTRLSRLSLDNNQISDISPLAGLINLYVLNLNYNQI
RDISPLVANSGLAGDDVYLQYNYLDLTPGSAAMNDIQTLQSRGVYVVYEPQHEVTKYTLD
LAVNPEGSGTVTGAGTYAAGYTVSITATPNEGWEFANWTDGTGATVSSEATFDYPMPARD
TALIANFEPAPPVLTRIDVSPVEAALEVGETRQFTATGYDQYGNTIPTGEIVWSSTNEAV
GTIDASGMFTALAAGSTELVAEANGISGKANVTVTPAAPVLTSIAVTPESPALEVGTTQQ
FTATCYDQYGQTMPEVTVSWSSSNTSVGTIESNGMFTALTAGSTTVTASAAGISGQTVAT
VNPAAPAVTRIAVSPLSVTLDIGDTQAFVATCYDQYENEMPGTSVSWASDSTTVGTIDAT
GLFTATAEGSATVTATAGDISGTAEVAVNPAPPVLTSISVSPAAPTIDAGDTQQFTATCY
DQYGQTMPEVTVSWSSSNISVGTIESNGMFTALTAGSTTVTASAEGISGQAVATVNLAAP
VITRIAVSPPSVTLDIGDMQTFVATCYDQYENEMPGTDVSWSSDDTTVGTIDATGLFTAT
AEGSATVTATAGEVSGTAEVTVNPAPPVLTSISVSPAAPTIDVGETQQFTAICYDQYGAP
ISDVSVIWSSENETVGTIDTSGLFTAIEEGATTITASANGISGTATVTVTPAPRVLTTVD
VSPATADIAVGETEQFTATCYDQNGEVMPDVSVTWSSSNEAVGTMTAGGIFTAHSEGATT
VTASAEGVSGSASVTVRRVNTAPIAVDDAFTTNIRTQLTVPAPGVLENDTDSDGDVLTAA
LVSKPSNGVLTLNTDGSFTYIPKGNFIGTDTFTYKANDGSLNSSVATVTITVLATNHAPI
AADDTVTMTQDTTYAAPAPGVLENDQDPDGDTVTAKLVSKVTYGSLKLKKDGSFTYIPKP
GFTGEDSFTYQTSDGKLSSDIATVRITVEPTAVIPPVADFSASPLGGKAPVFVQFTDTST
GTINSWTWTFGDGGTSTEQNPQYKYTRPGTYTVSLTVTGPGGSDTKTVTDYIQVTGKKA
NT seq 8280 nt NT seq  +upstreamnt  +downstreamnt
atggatagatcgagagtaatagcaggggccatcgtcatcctccttgccgtcgccgtgctg
gcagtgccggtggcggcggaagagtatgtgtttgtgacgaagtggggggaatatggtacg
ggagaggggttcaaggatccctttgacatagctatagacactgccggccacatctatatt
actgaaaccgatgccaaccacatcctgcagcgcatcctgaagctcgacagctccatgaac
ttcattaccaaatggggctcatacgggactggcaatgggcagtttaatgggccccagggt
attgccgtgaatgctgctggtaacgtctatgtcgctgatacatacaaccaccgcatccag
aaattcgattccagtggtaacctccttaccaagtggggttcatgggggtccggtgacggg
cagtttagttatcccgatagcgtcgccgtggacgctgccgggaacgtctatgtctccgat
accaacaatggccgtatccagaagttcgactctgatggcactttccttgggaaatgggga
tcatggggatctggcgatggacagttaaggttctcacaagatctggttgtggatgctgca
ggcaacatatatgtggccgaatatggtaaccatcgcatccagaaattcgattccaatggt
aattttctctggaaaaagggttcatcggggtccggcgatgggcagtttctctctccttat
ggtattaccgtggacgctgctggaaacgtctatgtcgctgatacttggaaccaccgcatc
cagaaattcgattccagtggcaatttcctgacgaaatggggttcacgggggtctggtaat
ggacaatttagtgagccctttggcgttgccgtggacagtgctggcaacgtgtatgtaact
gagagaggtaacgaccgcgtccagatgttcgccccggcctccgccctgaccgtcaccggg
atcgttcccgcttccggactcaacacagggagcgtgagcatcaccgatctctccggcacc
gggtttgccaacggtgcgaccgtgaacctcacccggaccggagagacgaacatcgtggca
accgatgtctccgtcctttcttcgacgcagatcacctgcacccttgacctgaccggcgcc
gttgcaggatcctggaacgtcgtagtgacgaatcctgacaatcagttcgcaactcttacc
gatggatttaccgtgaatgcagagaaccgtgccccggtcgcggaagacgacacctacacc
acagatgaagatacgcttctcaccatctccgctcccggagtgctggcgaacgataacgac
cccgacggggatgccctcaccgcagtcctggtcgacgacgtttcgaacggtacattaacc
ctgaacgctgacggctcgttcacgtacctgcccaatacaggattctctgatatagacacg
ttcacctatacggcgaacgatggaactcagagttctaacgttgctacagtatccataaac
gtcaatccggcttcggcagttttaacatcgattgtggtaaccccggtacaaccaatcctt
gaaattggtggaacccagcaattcacggcaaccggctatgatcagtatgggactccccta
cccaccggtgagatcgtctggtccagcacgaataccacggtgggaacaatcgatgcgaca
ggcctcttcactgcaaccgcagaaggatccacgacagtcaccgccactgcgggggaggtt
tccgggacggctgaagtgacggttaaccccgccctgaccgtcaccgggatcgttcccgcc
tccggacctaacacagggaacgtgagcatcaccaatctctccggcaccgggtttgttgac
ggcgcgaccgtgaacctcacccggaccggagagacgaacatcgtggcaacggatgtttcc
gttctctcttcgacgcagatcacctgtacgctggacctgaccggcgccgctgcggggtcc
tggaacgtggtggtgacaaatccagatggacggtacgatatcctgtcagatgggtttgcc
gtcgtggcggcgagtgagattgtaacgttcaacgatcccaacctcgaggctacagtgcgt
ggtgcgctgggtaagcccgtgggagatattacggccgatgacatggccacatttattact
ctaggtgcagattggagaggaatccgtgatctatcggggctggagtatgcggtcaacctg
cagcatctctatctccaacagaaccgccagatcagcgacctcggcccccttgccggcctg
acagacctgcagactcttgacctttggaacaaccagatcagcgacctcagccccctcgcc
ggcctgacaaacctgtctgtgctcctccttggttccaaccagatcagcgatatcggcccc
cttgctggcctgacagacctgcagcgtcttcacctttatgacaaccagatccgcgacatc
ggcccccttgccggcctgacaaacctgtgggaacttcgcctttataacaaccagatccgc
gacatcggcccgctggttgccaacagcgggctcggctcaggcgacgaggtgtaccttcag
tacaactacctcgacctcaccccggggtccgctgatatgaatgacatccaaacactgcaa
agcagaggagtgtacgtcgcctatgaaccgcaaaacccggtgccgacctatacactcgac
ctcgccgtgaatcctgagggcggcggcaccgtcaccggagccgggacctacaaagctggc
gataccgttcccattacagcgacacccaatgaaggctgggagtttgtcaactggacaaat
gagacaggagcgacagtaagttccgagccaaacttcgactatcccatgcccgaaggcgac
gtggcgctcactgccaactttgaaggcgaagccatcacctacacgctcggcctggcagtg
aatcctgctggtagtggtaccgtcaccggagccggcacctacgcagcgggagacacagtc
tcggtcacggccacaccgaatgatggctacacctttgtcaactggacggacgaaacagat
gttacagtgagtaccgcagcgagtttcgactacaccatgcctgacggtgacgtgaccctc
accgctaacttcgcggcgatcacctacacccttgaccttgcagtgaatcctgaaggcagc
ggtacggccaccggggccggcacctacgcagctggagcaacagttcccatcacagcgaca
cccaatgaaggctgggagttcgccaactggacggatgggacaggagcgacagttagttcc
gaggcgaccttcgactataccatgccagcccaggaaacggcactcaccgccaatttcgag
ccggcacctcccgtccttgctcgcattgaggtatcaccggccgaagcaaccctcgaggtc
ggggcgacccggcaattcacggcaaccgggtatgaccagtacgggaatcccctatctgtc
ggtgagatcgtctggtccagcacgaatgaggccgtcgggacaatcgatgcgtccggtatg
tttaccgcgctggctgccggcagtacagagctcgttgccgaagcaaacggaatctcaggc
aaggcgaacgtcacggttactcctgcagctcctgtcctaacatccatcgcggtaacgccg
gaatcccctgcgctggagattggaaccactcagcagtttactgcgacctgctacgaccaa
tatggccagacgatgcctgacatggccgtctcatggtccagcagcaatacttcagtggga
accatcgagtcaaacgggatgttcacagcgcttaccgccgggtccaccacggtgacggcg
tctgctgcgggcgtttctggacagacggtggcgaccgtgaatccggctgcccccgtagta
acccgtattgcagtatcgcccccatccgtcaccctggatatcggtgatacgcaagcgttt
gtggccacctgctacgatcagtatgagaatgagatgcccgggaccagtgtatcctgggca
agtgatagtacaaccgtaggaaccatcgacgcgacaggcctcttcactgcaaccgcggaa
ggatccacgaccgtcaccgccactgcgggggatgtctccgggacggcagaagtgagagtt
aatcccgccctgaccgtcaccgggattgttcccgcctccgggcctaacaccggccctgtg
agcatcaccgacctctctggcaccggttttgctgacggcgcaaccgtgaaactcacccgt
gacggtgaggcagatatcgtggcaacagatgttgccgtcctctccccgacgcagatcacc
tgcacgctggacctgaccggcgccgctgtgggtacatggaacgtggtggtgacgaatcct
gatgagcagtacgatatcctgtcggatgggtttgccgtcgtggcggcgagcgaggttgta
acgttcaacgatcccaacctcgaggctgcagtgcgccaggaactgagcaaacccaaggga
gacattaccgctgacgatatggccacgcttactaggctctctgcagcaggtagaggaatc
cgtgatctgtcgggactggagtatgcggtcaacctgcagactctttatatctccaacaac
cagatcagcgatctgagcccccttgccggactgaccaacctgcagactctttggcttcag
gataaccaggttagcgacctcagccccctcgccggcctgaccaacctgcagcgtctttgg
ctcaaccaaaaccaaatccgcgatgtcagtcccctcgccggcctgacaaatctgcgtgag
cttctcctcgctgtcaaccagatcagcgatctgagccccctcgccggactgaccaacctg
gggtatgttcagctatatcgcaaccagatcagcgatctgagccccctcgccggactgacc
aacctggggtatgttcagctatatcgcaaccagatcagcgatctgagccccctcgccgga
ctgaccaacctgtattttcttgatatctcctacaaccagatcagcgatctgagccccctt
gctagcctgaccaacctgtattttcttgatatctcctacaaccagatcagcgatatcagc
cctcttgccggtctcacgcgcctgagtcgtctttctttagataataaccagatcagcgat
atcagccccctcgccggcctgatcaatctgtatgttctaaatctcaattacaaccagatc
cgcgatatcagccccctggttgccaatagtgggctcgcgggggacgatgtgtaccttcag
tataactacctcgacctcaccccagggtctgctgcgatgaatgacatccagacgctgcaa
agcaggggagtgtacgttgtctatgagccgcaacatgaagtaacgaaatacacgcttgac
ctcgccgtgaatcctgaaggcagcggcactgtcaccggcgccggtacctacgctgctgga
tataccgtttccatcacagcgacacccaatgaaggctgggagttcgccaactggacggat
gggacaggagcgacagtaagttccgaggctacctttgactatcccatgcccgcccgggac
acggcgctcatcgccaatttcgagccagcacctcccgttctcacccgcattgatgtatca
ccggtcgaagcagcccttgaggtcggggagacccggcaattcacggcaaccgggtatgac
cagtatgggaatactatacccaccggtgagatcgtctggtccagcacgaatgaggccgtc
gggacaatcgatgcgtccggtatgtttaccgcgctggctgccggcagtacagagctcgtt
gccgaagcaaacggaatctcaggcaaggcgaacgtcacggttactcctgcagctccggtc
ttaacatctatcgccgtaacgccagaatccccggcgctggaggtcggaaccactcagcag
tttaccgcgacctgctacgaccaatatggccagacgatgcctgaggtgaccgtctcatgg
tcaagcagcaatacctcagtgggaaccatcgagtcaaacgggatgttcacggcactcacc
gctggatccaccacggtgacagcgtctgctgcgggcatctctggacagacggtggcgacc
gtgaatccggctgccccggcagtaacccgtattgcggtatcgcccctatccgttaccctt
gatatcggtgatacgcaagcgtttgtggccacctgttacgatcagtatgagaatgagatg
cccgggaccagtgtatcctgggcaagtgatagtacaaccgtaggaaccatcgacgcgaca
ggcctcttcactgcaaccgcagaaggatcagcgacagtcacagccaccgcgggggatatc
tccgggacggctgaggtggcggttaacccggctcctccagtcctgaccagcatttcggtt
agccctgccgccccaaccatcgatgcaggagacacccagcagtttaccgcgacctgctac
gatcagtatggccagacgatgcctgaggtgaccgtttcgtggtcaagtagcaatatttca
gtgggaaccatcgagtcaaacgggatgttcacggcactcaccgctggatccaccacggtg
acagcgtctgccgagggcatctctggacaggctgtggcgactgtgaacctggcggctccc
gtgataacccgtattgcggtatctcccccatccgttacccttgatattggtgacatgcaa
acgtttgtggccacctgctacgatcagtatgaaaacgagatgcccgggactgatgtttcc
tggtcgagtgatgataccacggtaggaaccatcgacgcgacaggcctcttcactgcaacc
gcagaaggatcagcgacagtcacagccactgcaggggaggtttccgggacggctgaggtg
acagttaacccggctcctccagtcctgaccagcatctcggttagccctgccgccccaacc
attgatgtaggagagacccagcagtttaccgcgatctgctacgaccaatatggcgctcca
ataagcgatgtgtcagtcatatggtcgagcgagaatgaaacagtcggaaccatcgatact
tcaggactgttcactgcaatcgaagagggtgcgacaacgattaccgcttcggcgaatggg
atctctgggacggctacggtgacggtcactcctgcgccacgtgtattgacaaccgttgat
gtgtcacccgccacagcagatatcgccgtaggtgaaacagagcaatttaccgcaacctgc
tatgaccagaacggcgaagtgatgccggacgtctctgtcacctggtccagcagcaatgag
gccgttgggactatgactgccggcggcatcttcactgcacactcggaaggtgcgacgacc
gttacagcatctgccgagggagtctctggatcagcttctgtcacggtgaggagagttaat
accgctcctatcgctgtcgatgatgcgtttacgacgaatatacgaactcaactgaccgtt
cctgccccgggggtgctggagaatgacactgattccgatggtgatgttctgaccgccgcc
ctggtttccaagcccagtaatggcgtcctcaccctgaacaccgatgggtccttcacatat
atccccaaagggaattttatcggcacggacaccttcacatacaaagcaaatgacgggagc
ctgaattcttcggtggcgaccgtcacgatcacggttctggctacgaaccacgctccaatc
gccgcggatgacaccgtcacgatgacgcaggacaccacctatgcggcgcctgcgcccggg
gtgctggagaacgatcaggatcccgatggggacaccgtgactgcgaaactggtcagcaag
gttacgtatggctcgctcaaattgaaaaaggacgggtccttcacgtatatccccaaaccc
ggtttcaccggtgaagattcattcacctaccagaccagtgatggcaagctcagttccgat
attgccacggtcaggattacggtggagcccacagcggtgatcccacccgtggcggatttc
tcggcttccccgctaggtggcaaagctcctgtattcgtacaattcaccgatacctctacc
ggcacaatcaacagttggacctggaccttcggagacggcgggaccagtaccgagcagaac
ccccagtacaagtataccaggcccggaacctacacggtatccctgacagtcaccggacca
ggaggatcggatacgaagacggtcacggattacattcaggtgacgggaaagaaggcgtaa

DBGET integrated database retrieval system