KEGG   Mycoplasma bovis HB0801: Mbov_0347Help
Entry
Mbov_0347         CDS       T02143                                 

Definition
(GenBank) putative lipoprotein
Organism
mbi  Mycoplasma bovis HB0801
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RTTN_N Presenilin MAJIN
Motif
Other DBs
NCBI-ProteinID: AFM51713
LinkDB All DBs
Position
414995..415777
Genome map
AA seq 260 aa AA seqDB search
MKKSKYILLTTLSPIISLPFLSASCITEAKSDNKMEKDIKINENTDEKNSSETMNNKQKQ
DKSSIDSKMEEKADNKTEKDIKINENTDEKNSSETMNNKQKQDKSSIESKMKEKTEKQDS
KTNSEKQDSETDDSSNELTIPSESTPKDMPTENSEINDYLDKVKEYGKEASEFYELLSKL
FKTKYKDKIIQKIGKFEKIIKEFSKLYEGTKNNLDQIIEGFKEPDFKKALLELLNSYKES
REEIKNAIKELKEIENESRF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctaaatatatattattgacaacactatcgccaattatctcattgccattt
ttatctgctagttgcatcaccgaagcaaaatcagataacaaaatggaaaaagatattaag
ataaacgaaaatacagatgaaaaaaattcttctgaaacaatgaataacaaacaaaaacaa
gataaaagcagtatagattcaaagatggaagaaaaagcagataacaaaacggaaaaagat
attaagataaacgaaaatacagatgaaaaaaattcttctgaaacaatgaataacaaacaa
aaacaagataaaagcagtatagaatcgaaaatgaaagaaaaaacagaaaagcaagattca
aaaactaactcagaaaaacaagattcagaaactgatgacagtagtaatgaattaacaata
cctagtgaaagcacaccaaaagatatgccaacagaaaattctgaaataaacgactattta
gacaaagttaaggaatacggaaaagaagcatcagaattttatgaattactttctaaatta
tttaaaacaaagtataaagataaaataattcaaaaaattggtaagtttgagaaaataatc
aaagaattttctaaattatatgagggaacaaagaacaacttagaccaaattattgaagga
tttaaagaacctgattttaagaaagcattattagaacttttgaatagttacaaagaatct
agagaagaaataaaaaatgcaattaaagaattaaaagaaattgaaaatgaaagtagattt
taa

DBGET integrated database retrieval system