KEGG   Mycobacterium tuberculosis variant bovis BCG Korea 1168P: K60_017030Help
Entry
K60_017030        CDS       T02451                                 

Definition
(GenBank) transmembrane ATP-binding protein ABC transporter cydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
mbk  Mycobacterium tuberculosis variant bovis BCG Korea 1168P
Pathway
mbk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mbk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    K60_017030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mbk02000]
    K60_017030
Transporters [BR:mbk02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    K60_017030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane AAA_16 AAA_29 FtsK_SpoIIIE AAA_28 Mg_chelatase AAA_22 NACHT AAA_18 CbiA AAA_24
Motif
Other DBs
NCBI-ProteinID: AGE67613
LinkDB All DBs
Position
complement(1795437..1797167)
Genome map
AA seq 576 aa AA seqDB search
MNRPSAVSRRQRDLLAASGLLGPRLPRILAAVALGVLSLGSALALAGVSAWLITRAWQMP
PVLDLSVAVVAVRAFAISRGVLHYCERLATHDTALRAAGRARTLIYHRLAHGPAAAAVGL
HSGDLAARVGADVDELANMLVRALVPIAVAAVLAVAATAVVAAVSVPAAVVLAVCLLVAG
VVAPWLAGRTAAAQEAIARQHRGMRDTSAMIALEHAPELRVAGALRNVIADSQRRQHAWA
DALDAAARTGAIAEAMPTAAIGASLLGAVVAGIGMAPTVAPTTLAILMLLPLSAFEATVA
LPAAAVQLTRSRIAAARLLDLTGSNRVRETESTVSARLPVGTGVLAADVCCGHQEAQSIR
VTIDLPPGARLAVTGASGAGKTTLLMTLAGLLPPVHGRVLLDGTNLSDFDEDELRSAVSF
FAEDAHIFATTVRDNLLTARGDCPDDELIEALDRVGLCGWLAGLPEGLSTVLIGGAQAVS
AGQRRRLLLARAVLSPARIVLLDEPVEHLDAANADLLRDLLAPNSGIMSAMRTVVVATHH
LPNDIQCAELSIATDQRCRRRGTNSSDNNTNASAKT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaccgagtgctgtgagtcgccgccagcgggacctgctggccgcgtctgggctg
ttgggtccccggttgccccggatcttggcggccgtcgcgctgggcgtgctgtcgctgggc
agcgcgctggccctggccggggtgtcggcctggctgatcactcgggcctggcagatgccg
cccgtcctggacctgtcggtggcggtcgtggcggtgcgggcgttcgcgatttcgcgcggc
gtgctgcactactgcgagcgactggccacccacgacaccgcgttgcgggccgccggccgg
gcccgcacccttatctatcaccggctggcccacggaccggcggcggccgccgtcgggctg
cacagcggggacctggcagcacgcgtcggcgcggacgtcgacgaactggccaacatgctg
gtgcgtgctctggtgccgatagccgtcgcagcggtgctggcagtagccgcgaccgcggtc
gtcgcggccgtttcggtgccagccgccgtggtactggcggtctgccttttggttgccggc
gttgttgcgccctggcttgccggcagaaccgccgcagcgcaggaagcgatcgcccgccaa
catcggggcatgcgcgacacgtcggcgatgatcgcccttgagcatgcccccgagcttcgt
gtcgccggtgccctacgcaacgtcatcgccgactcacaacggcgccaacatgcctgggcc
gatgcgctcgacgccgccgcacgaacgggggcgatcgccgaggccatgccgaccgcggcg
atcggggccagcctgctgggcgccgtggtggccgggatcggcatggcccccacggtcgcg
cccacaacactggccatcctgatgttgttgccgctgtccgcattcgaggcgaccgttgca
ctacccgccgccgccgtccagttgacacggtcgcgcatcgcggcggctcgtctgctcgac
ctgactgggtcaaaccgggtccgcgagaccgaatccacggtgtcggcgcgactgccggta
ggtaccggggtgctagcggccgacgtgtgttgcggtcaccaagaggcgcagtcgatccgg
gtgacgattgacctaccgccgggtgcccggctggccgtcaccggcgcgagcggcgccggc
aagacgacgctgttgatgacgctggccggcttgctgccgccggtgcacggccgggtgttg
ctggacggaactaacctgagcgacttcgatgaggatgaattacgcagcgctgtcagcttt
ttcgctgaagatgcgcatatctttgctaccaccgttcgggacaacttgctgaccgcccga
ggagactgccccgatgacgaactgatcgaggccctggatcgggtcggcctgtgcggctgg
ctcgccggcctgcccgaggggttgtcgacggtgttgatcggtggcgcgcaagcggtctcg
gcgggtcagcgcagaaggttgctgctcgcccgggcggtgctttccccggctcggatcgtg
ttgctcgacgaacctgtcgaacacctcgacgccgccaacgccgaccttctgcgcgatctg
ctggccccgaactccgggatcatgagcgctatgcggaccgtggtggtagccacccaccac
ctgcccaacgacattcaatgcgccgagctgtccatagcgacggatcagagatgtcgccgc
cgcgggacgaactccagcgacaacaacaccaacgccagcgcaaagacctga

DBGET integrated database retrieval system