KEGG   Mycobacterium tuberculosis variant bovis BCG Korea 1168P: K60_034550Help
Entry
K60_034550        CDS       T02451                                 

Definition
(GenBank) molybdopterin cofactor biosynthesis protein D/E
  KO
K21142  MoaE-MoaD fusion protein [EC:2.8.1.12]
Organism
mbk  Mycobacterium tuberculosis variant bovis BCG Korea 1168P
Pathway
mbk00790  Folate biosynthesis
mbk01100  Metabolic pathways
mbk04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mbk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    K60_034550
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    K60_034550
Enzymes [BR:mbk01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     K60_034550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE ThiS Attacin_N
Motif
Other DBs
NCBI-ProteinID: AGE69365
LinkDB All DBs
Position
complement(3703078..3703743)
Genome map
AA seq 221 aa AA seqDB search
MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESI
APASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRN
NNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGAS
APHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattactgtcaatgtgctctactttggcgcggttcgcgaagcgtgcaaggtcgctcac
gagaagatctcactcgaaagcggcaccaccgtcgacggcttagtcgaccaattgcaaatc
gactatccgccacttgctgattttcgcaagcgagtgcggatggccgttaacgaatccata
gcgccagcatcaacgattctcgacgatggcgacacggtggcgttcataccgcaggttgcc
gggggctccgatgtctactgccggctcaccgatgagccgctgagcgtcgatgaagtgctc
aacgcgatatctggaccttcccagggcggcgccgtcatcttcgtgggtaccgtgcgtaac
aacaacaacggccacgaagtgaccaagttgtactacgaggcctatccggccatggtgcac
cgcacgctgatggacatcatcgaagagtgtgaacgacaggccgacggtgtgcgagttgcc
gtggcacaccggaccggtgaattgcgcatcggtgatgcggcggttgtcatcggtgcttcg
gctcctcaccgcgcggccgcgttcgacgccgctcgcatgtgcatcgagcggctcaaacag
gatgtgccgatatggaagaaggagttcgcactcgacggtgttgagtgggtggccaatcgg
ccatga

DBGET integrated database retrieval system