KEGG   Mycobacterium tuberculosis variant bovis BCG Korea 1168P: K60_035130Help
Entry
K60_035130        CDS       T02451                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbk  Mycobacterium tuberculosis variant bovis BCG Korea 1168P
Pathway
mbk00071  Fatty acid degradation
mbk00280  Valine, leucine and isoleucine degradation
mbk00281  Geraniol degradation
mbk00310  Lysine degradation
mbk00360  Phenylalanine metabolism
mbk00362  Benzoate degradation
mbk00380  Tryptophan metabolism
mbk00410  beta-Alanine metabolism
mbk00627  Aminobenzoate degradation
mbk00640  Propanoate metabolism
mbk00650  Butanoate metabolism
mbk00903  Limonene and pinene degradation
mbk00930  Caprolactam degradation
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
mbk01120  Microbial metabolism in diverse environments
mbk01130  Biosynthesis of antibiotics
mbk01212  Fatty acid metabolism
Module
mbk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    K60_035130
   00650 Butanoate metabolism
    K60_035130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K60_035130
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K60_035130
   00310 Lysine degradation
    K60_035130
   00360 Phenylalanine metabolism
    K60_035130
   00380 Tryptophan metabolism
    K60_035130
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    K60_035130
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    K60_035130
   00281 Geraniol degradation
    K60_035130
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K60_035130
   00627 Aminobenzoate degradation
    K60_035130
   00930 Caprolactam degradation
    K60_035130
Enzymes [BR:mbk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     K60_035130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGE69423
LinkDB All DBs
Position
3780748..3781638
Genome map
AA seq 296 aa AA seqDB search
MRRRAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQ
NALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYN
ESLAVCLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGF
TEADTVARLIGPAALKYLLFSGELIGIEEAARWGLVQKVVAPQDLAAATAKLVGQVCRQS
AVTMRAAKVVANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcgtgcaatgacgaagatggacgaggctagcaatccgtgcggcggggacatc
gaagctgagatgtgccagttgatgcgcgagcaaccacccgccgaaggcgtcgtcgatcgt
gtcgcgctgcaacgccatcgaaacgttgcgttgatcacgctgagccatccgcaggcgcag
aacgcactcaacctggcgagctggcgtcggctgaagcggctgctggacgatctcgccggc
gaatcggggctgcgggcggtggtgctgcggggcgccggtgacaaggcgttcgccgcgggt
gccgacatcaaggagtttccgaacacccgcatgagcgccgcggacgccgcggagtacaac
gagagcctggccgtctgcctgagggcgttgaccacgatgccgatcccagtcatcgcggcg
gtccgggggctcgccgtcggtggcggctgtgagctggcgacggcctgcgatgtgtgcatc
gcgaccgacgacgcgcgcttcggcatcccgctgggcaagctcggcgtcacgacgggcttc
accgaggcggacaccgtcgcgcgcctcatcggtccggcggcgctgaagtatctgttgttc
agcggagaactgatcggcattgaggaagccgcccgctggggattggtgcaaaaggtcgtc
gcaccacaggatttggcggccgcgacggccaaactggtcggccaggtctgtcggcaatcc
gcggtgaccatgcgtgcggcgaaggtggtcgccaacatgcacggccgagcgctgaccggc
gccgacaccgatgcgctgatccggttcggtgtcgaagcctacgagggggcggacctacgc
gaaggggtggcggccttcagccagggacgcccacccaaatttgatgattag

DBGET integrated database retrieval system