KEGG   Moraxella bovoculi: AAX09_01260Help
Entry
AAX09_01260       CDS       T04324                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mbl  Moraxella bovoculi
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAX09_01260
Enzymes [BR:mbl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AAX09_01260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_oxidored NAD_binding_8 FAD_binding_2 Thi4 AlaDh_PNT_C DAO NAD_binding_7 NAD_binding_9 K_oxygenase Glutaredoxin FAD_binding_3 3HCDH_N Shikimate_DH DSBA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AKG18263
LinkDB All DBs
Position
269625..271181
Genome map
AA seq 518 aa AA seqDB search
MLDQSLLDAVQTYSANMTRPIQMILGQGEHAKRAELIDFLEKIASTSDKIGFDKSVVDTD
LSAMSFKIATDNRDTGIVFSGIPGGHEFTSLLLAILHAGGHTMKLDEGIQELVKRIQKPL
KFQTFVSLSCHNCPDVVQALNQFAVLNDGIENEMIDGGVFPKLVEANNIQGVPAVFLNGK
PFLNGKVDTARIIDKLQAKYPDLLSEGVPEELKTQDVTVIGGGPAGSAAAIYTARKGLRV
ALVADRIGGQVKDTQDIENLISIPLTNGNTLAGNLSTHIKEYNIIVKEHVSVSSIEEVKD
GYQVTLNTGASWTSRTLIIATGAKWRKLGVKGEDENIGNGVAYCPHCDGPFFKGKPVAVI
GGGNSGVEAALDLAGIVEHVTVLEFDDKLRADQVLIDKAEARDNITIIKNAATQEITANS
GKVDGLIYQDRASGENVTLPLSAVFVQIGLVPNSDVVKDLVDVTAHGEIEIDAKCRTNKP
GVFACGDVTTVPFKQINIAMGEGSKAGLAVFEYLMMNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaatcattattagatgctgttcaaacgtacagcgccaacatgactcgtccg
attcagatgattttaggtcaaggtgagcacgccaaacgtgctgagctgattgattttctt
gaaaaaatcgccagcacctctgataagatcggctttgataagagtgttgtggataccgac
ctatctgcgatgagctttaaaattgccaccgataatcgcgataccggtattgtgtttagc
ggtattcctggcggtcatgaattcacgtcactactgcttgcgattttgcatgctggtggt
cacaccatgaagctagacgaaggcattcaagagcttgttaagcgaatccaaaaaccatta
aaattccaaactttcgtatcgctgtcttgccataactgcccagatgtcgtacaggcattg
aatcagtttgccgtactcaacgatggcatcgaaaacgagatgattgacggcggtgtgttc
ccaaagcttgtagaagctaacaacattcaaggcgtgcctgcggtattcctaaatggcaaa
ccattcttaaacggtaaagtggacactgcgcgtatcatcgataagctacaagctaaatac
cctgatctgctgtctgagggcgtgcccgaagaattaaaaacccaagacgtgaccgtcatc
ggtggcggtcctgcaggttcggcagctgccatctatactgctcgtaagggtctgcgcgtg
gctctagtggctgatcgtattggtggtcaggttaaagacactcaagacattgagaatcta
atctcaatcccattaactaatggtaatacgctagctggcaacctatccacgcatatcaaa
gaatacaacatcatcgtcaaagagcacgtgagcgtatcaagtattgaagaagtgaaggat
ggctatcaagttaccctaaacacgggtgcaagctggacgtcacgcacactaatcatcgca
acaggcgccaaatggcgtaagcttggcgttaaaggcgaagatgagaacatcggcaatggc
gtggcgtactgtccacactgtgatggcccattcttcaagggtaagcctgtggcggttatc
ggcggcggcaactctggcgttgaagcagcacttgacttggcgggtatcgttgagcatgtg
accgtactagagtttgatgataagcttcgtgctgaccaagtactgatcgataaagctgaa
gcgcgtgataatatcactatcatcaaaaatgccgccactcaagaaatcaccgctaatagt
ggtaaagtggatggcctaatctatcaagaccgagcgagtggcgagaatgtgacgttgcca
ttgtcagcggtgtttgtacagattggtctggtgccaaactctgatgtggttaaggatttg
gtggatgtgacagctcatggcgagattgagattgatgccaaatgtcgcaccaataagcca
ggcgtgttcgcatgtggtgacgtgacaaccgttccatttaagcaaatcaacatcgccatg
ggcgaaggttcaaaagcaggcttggcagtgtttgagtatctgatgatgaattcttaa

DBGET integrated database retrieval system