KEGG   Moraxella bovoculi: AAX09_01585
Entry
AAX09_01585       CDS       T04324                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
mbl  Moraxella bovoculi
Pathway
mbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAX09_01585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mbl01001]
    AAX09_01585
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mbl02022]
    AAX09_01585
Enzymes [BR:mbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AAX09_01585
Protein kinases [BR:mbl01001]
 Histidine kinases
  OmpR family
   AAX09_01585
Two-component system [BR:mbl02022]
 OmpR family
  RstB-RstA
   AAX09_01585
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 SCAB_CC
Other DBs
NCBI-ProteinID: AKG18318
UniProt: A0A0U2BBR3
LinkDB
Position
331408..333093
AA seq 561 aa
MALISLTERSIFFRIYAGLLLVCLAVAFFAYLLVDTINQERIQSYREKASTGAFYLISQG
VAHQQEPSRRQYWLSDASRLFGESFSVVPMNTVEFKGREIRRLNEEKTVVRYDSATKEST
MYHRIAGEDNLLTVKLSQVGERQVRALTIFLLDDLSYYPTIEAKTGRLQFLSQKFSYPIQ
IRPIDSVGLDSSQIARIRRDEPVILYKDGDGIQNSLISFVVASEVDTSVIVIGPIDLFNW
FPLNLIASVVLICLLLISLGVYGLIFPLERRLQLLQAGLKRVMQGDLNTRVQVVGHDDVA
RLSSTFNAMTQHIKRLIEAQRELTRAVSHELRTPVARIRFAVDMLADEDDHESRQFQKQY
IDEDIESLNELIDEILTYAKLEEGSPKLEWELVDLGDLVKQVERETNALGKDIKVLVNIT
SPKAQAMADKRYLHRVVQNLAGNAMRYAESSIIISTGVVKGRAFVSVEDDGQGIKEEDRE
KVFVPFARLDDSRTRASGGYGLGLSIVSRIAFWFNANLKVDESPDLKGARFIMDWPAKQT
GVYIVADELTQAKSDKVLIGD
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcgctaatttctttaactgaacgcagtatcttttttcgcatttatgcagggctttta
ttggtgtgccttgcagtggcttttttcgcctatttgcttgtagataccatcaaccaagag
cgtatccaatcctatcgcgagaaagcctctacgggcgctttctatcttatcagtcaaggc
gtggcgcatcaacaagaaccaagtcgtcgtcagtattggctgtcagatgccagtcgattg
tttggtgagagtttctcagttgttccaatgaacacggttgaatttaaaggtcgtgaaatc
agacgtctcaacgaagaaaaaaccgtggttcgttatgactccgccaccaaagaatcaacc
atgtatcaccgaattgctggcgaagataatctattaacggttaagctgtcccaagttggt
gagcgtcaggtgcgtgcattgacgattttcttgttggatgatttgtcttattatccaact
attgaggctaagacagggcgcttgcagtttttaagccaaaaattttcttaccctattcaa
attagacccatagattcggtgggtcttgattctagccagattgcccgcattcgtcgtgat
gagccagtcattctctataaagacggcgatggtattcaaaactcattgatctcatttgtc
gtggcatcagaagttgatacttcggttattgtcattggtcctattgatctttttaattgg
tttccgctgaatctgattgccagtgtggttttgatttgtttattgctcattagtttgggt
gtttatggtttgattttcccgcttgagcgcagattacagttgctacaggcgggtttaaaa
cgtgtcatgcagggcgatctaaatactcgtgtgcaggtcgtggggcatgatgatgttgcg
cgtctttcatctacttttaatgccatgacgcagcacatcaagcgtttgatcgaggcgcaa
agggagctgacgcgtgcggtgtcgcatgagcttcgtacgcctgttgcgcgtattcgcttt
gcggtggatatgctggctgacgaagatgaccatgagtcaagacaatttcaaaaacaatat
atcgatgaagacattgagtctttaaatgagttgattgatgagatcttgacctatgctaag
ttggaggaaggttcgccgaagcttgagtgggaattggtcgatttgggtgatctggtgaag
caggttgagcgtgagacgaatgcccttggtaaggacattaaggttctagtgaatatcact
tcgcctaaggcgcaggcgatggcagacaagcgttatttgcatcgtgtggtacagaacttg
gcaggtaatgccatgcgatatgctgagagcagcattatcattagtacaggcgttgtgaaa
gggcgcgcctttgttagtgttgaagatgatgggcagggcatcaaggaagaggatcgtgaa
aaagtctttgtgccatttgcgcgtcttgatgacagtcgtactcgcgcatcaggtggttac
ggtcttgggctgtccatcgtctcacgaattgccttttggttcaatgccaatctaaaagtt
gatgaaagccctgatctaaagggcgcaagatttattatggattggccagctaagcaaacg
ggcgtgtatatcgttgctgatgaactgacccaagccaaaagcgataaagtgctgattggt
gattaa

DBGET integrated database retrieval system