KEGG   Mycobacterium tuberculosis variant bovis BCG Mexico: BCGMEX_0346cHelp
Entry
BCGMEX_0346c      CDS       T01727                                 

Gene name
aspC
Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mbm  Mycobacterium tuberculosis variant bovis BCG Mexico
Pathway
mbm00220  Arginine biosynthesis
mbm00250  Alanine, aspartate and glutamate metabolism
mbm00290  Valine, leucine and isoleucine biosynthesis
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01130  Biosynthesis of antibiotics
mbm01210  2-Oxocarboxylic acid metabolism
mbm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCGMEX_0346c (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    BCGMEX_0346c (aspC)
   00220 Arginine biosynthesis
    BCGMEX_0346c (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbm01007]
    BCGMEX_0346c (aspC)
Enzymes [BR:mbm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BCGMEX_0346c (aspC)
    2.6.1.66  valine---pyruvate transaminase
     BCGMEX_0346c (aspC)
Amino acid related enzymes [BR:mbm01007]
 Aminotransferase (transaminase)
  Class I
   BCGMEX_0346c (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AET17634
LinkDB All DBs
Position
complement(403134..404423)
Genome map
AA seq 429 aa AA seqDB search
MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRAVVTRYELVPGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQ
PDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGIGLLANMR
LCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgatggcaccattgtggacgtgacaacccaccagctgccctggcacaccgcc
agccatcagcggcagcgcgccttcgctcagtcggccaagctgcaggacgtcctgtacgag
atccgcggcccggtgcaccagcacgccgcgcggctcgaagccgaaggtcaccgcatcctc
aaactcaacatcggcaacccggcgccgttcggcttcgaagcacccgacgtgatcatgcgc
gatatcatccaggcgctgccctacgcgcaggggtactccgactcgcagggcatcctgtcg
gcccggcgtgcggtggtcacgcgctacgagctggtgcccggatttccccgattcgacgtg
gacgacgtctacctgggtaacggggtctccgagctgatcacgatgacgctgcaagccctg
ctggacaacggcgatcaggtgctgattccatcaccggactacccgctgtggacggcgtcg
acctcgctggctggcggcactccggtccactacctgtgcgatgagacccaaggctggcag
cccgatatcgccgacctggaatccaagatcaccgagcgcaccaaggcgctggtcgtgatc
aaccccaacaacccaaccggcgcggtgtacagctgcgaaatcctcacccagatggtcgat
ctggcccgcaagcatcaactgctgctgttggcggacgaaatctacgacaaaatcctctac
gacgacgccaagcacatcagcctggcatcgatcgccccggatatgttgtgcctgaccttc
aatgggctgtcgaaggcctaccgcgtcgccggataccgggccggctggctggcgatcacc
ggacccaaggagcacgccagcagcttcatcgagggcatcggcctgctggccaatatgcgg
ttgtgcccaaatgtcccggcccagcatgccattcaggttgcactgggcggccatcagagc
atcgaggacctggtgctgcccggcggccggctgctcgagcagcgcgacatcgcctggacc
aagctcaacgagatcccgggggtgtcgtgcgtcaaaccggcgggcgcgctgtatgcgttt
ccccggctagaccccgaggtctacgacatcgacgacgacgagcaactcgtgctcgatctg
ctgctgtcggagaagatcctggtcacccagggcaccgggttcaactggcccgcaccggat
catctgcgcctggtgacgctgccatggtcccgcgatctggcggccgccatcgagcggctg
ggtaacttcctggtcagttaccggcaatag

DBGET integrated database retrieval system