KEGG   Methanoregula boonei: Mboo_0084Help
Entry
Mboo_0084         CDS       T00578                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mbn  Methanoregula boonei
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mboo_0084
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mboo_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox FAD_oxidored Thi4 FAD_binding_2 HI0933_like GST_N_3 NAD_binding_8 GIDA K_oxygenase NAD_binding_7 FMO-like GST_N_2 FAD_binding_3 Thioredoxin_3 Lycopene_cycl DUF836 Thioredoxin_2 Trp_halogenase DAO
Motif
Other DBs
NCBI-ProteinID: ABS54608
UniProt: A7I4E7
LinkDB All DBs
Position
75022..76176
Genome map
AA seq 384 aa AA seqDB search
MMSTVTVYSTKNCPYCRMAKAFLEKYGVPYTAIDVGADTAAAHKMIALSGQRGVPVITVD
DEVIVGFDSQRLNELFGTHAAGETYDVIIVGAGPGGLTAAVYCARKLLKTLVVSESIGGQ
ALESWAIENYMGYRMITGEDLMKKFEEQVRTLDVRLELDRVNGVTMEENLFVVTTVSGLS
VKAKSLILTPGKQPRKLGVENEEKYLGRGLSICSTCDGPLFKDKKIAVVGGGNSALQTAV
EMSSIASSVSLLVRSTIKADPVYAKKLEGLKNITVHLHTQITALAGDPFLQHITIATEGQ
GEQRIDVDGVFIEVGWTPNTEIFDGLVELNGKKEIVVDVDGHTSRPGVFAAGDVTSVKSK
QIIIAAGEGAKAALEAYDYLMSLA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcacggtcaccgtttattccacgaaaaattgcccgtactgccggatggccaag
gcattcctggagaagtacggcgttccctacacagccattgatgtcggcgccgataccgct
gcggctcataagatgatcgcgctttcaggccagcgcggcgtaccggtaattaccgttgat
gacgaggtgattgtcggctttgactcccagaggctcaacgagcttttcgggacccatgca
gcgggagagacctacgatgtcatcatcgttggtgccggcccgggaggacttactgccgcg
gtctactgcgcccgcaaactcttaaaaacgctcgttgtttccgagagtattggcgggcag
gcgctggaatcgtgggccattgagaattacatgggctaccggatgatcaccggtgaagac
ttgatgaagaagttcgaggagcaggtccggacccttgacgtgcgcctggagctcgaccgg
gtaaacggcgttacaatggaggagaacctgtttgtggtaacaaccgtttccggcctttcc
gtgaaggcaaagagcctgatcctcaccccgggaaaacagccccggaaactaggggttgaa
aacgaggagaagtacctcgggcgcggtttgtccatctgctcgacctgcgatggcccgctt
tttaaggataagaagatcgctgttgtgggcggcggaaactcggcgctccagaccgccgtt
gagatgagcagcatcgcctcctccgtgagcctgcttgtccggagcacaatcaaggcggat
ccggtgtacgcaaaaaagcttgaagggctaaagaacattaccgtgcacctccacacgcag
atcaccgcgcttgccggcgatccgttcctccagcatatcacgattgcaaccgagggccag
ggggaacagcgcattgatgttgatggcgtctttatcgaggttggctggacgccgaatacg
gagatctttgatggcctggtggagctcaacgggaaaaaggagatcgtggtggatgtggac
ggccacacgagccggcccggggtatttgcggcaggcgatgtgacatcggtaaagagcaag
cagatcattatagctgccggtgaaggggcaaaggccgcgctcgaagcgtacgattacctg
atgagcctggcctga

DBGET integrated database retrieval system