KEGG   Methanoregula boonei: Mboo_0572Help
Entry
Mboo_0572         CDS       T00578                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mbn  Methanoregula boonei
Pathway
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01120  Microbial metabolism in diverse environments
mbn01200  Carbon metabolism
Module
mbn_M00357  Methanogenesis, acetate => methane
mbn_M00567  Methanogenesis, CO2 => methane
mbn_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mboo_0572
Enzymes [BR:mbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mboo_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: ABS55090
UniProt: A7I5S9
LinkDB All DBs
Position
complement(542205..543038)
Genome map
AA seq 277 aa AA seqDB search
MTAVAAKPAAGSAINPTAMVIGIVMLIILLGIAYVVSPGLGLMALIGVVIGGVLIGFGVH
FVPVGGAPAAMGQAPGIATGVAMLAAGAGLAGLFGGAWAADQGFVIAIITGGVGGGMMMA
ITCMMVNFVYIFGMGIPAASGKVLKDPITGDSQPEYKSQGTEGHGLPFVSFVGGVLGGVL
GGAGGTLIYLELLSLYKATLPNIMSISAAQALPIAVATAGIFAIGMFLVNSVLTAYNITG
TIEGPHDPKFKRWPRSVVASAVASALCGLVAILIVTF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtagcagcaaagccggcagcaggctcggcaataaaccccaccgccatggtg
atcggtatcgtcatgctcatcatcctgctcgggatcgcctacgtggtctcaccgggtctc
ggcctcatggccctgatcggcgtggtcatcggcggcgtcctgatcggattcggcgtccac
ttcgtgccggtcggcggcgcacccgcagcaatgggccaggcacccggtatcgcaaccggt
gtcgccatgctcgcagcaggtgcagggcttgccggactcttcggaggcgcctgggcagct
gaccagggatttgtcatcgccattatcacgggcggtgtcggcggcggcatgatgatggcc
atcacctgtatgatggtcaacttcgtgtacatcttcggcatgggcattcccgcagcttca
ggcaaggtattaaaggacccgatcaccggggactcccagcctgaatacaagtcgcagggt
accgaaggccatggcctgccgttcgtctcctttgtcggcggcgttctcggcggcgttctc
ggcggtgcaggcggcacgctcatctatctcgagcttctcagcctgtacaaggcaacgctc
ccgaacatcatgagcatctccgctgcacaggcactcccgatcgcagttgccacagcaggt
atctttgccatcggcatgttccttgtaaactcggtgctgaccgcatacaacatcaccgga
accatcgagggcccgcacgaccccaagttcaagcgctggccacggtcggttgttgcatcc
gcggttgcatcggcactctgcggtcttgtggcgatcctcatcgtcacgttttga

DBGET integrated database retrieval system