KEGG   Methanoregula boonei: Mboo_0673Help
Entry
Mboo_0673         CDS       T00578                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00020  Citrate cycle (TCA cycle)
mbn00620  Pyruvate metabolism
mbn00633  Nitrotoluene degradation
mbn00640  Propanoate metabolism
mbn00650  Butanoate metabolism
mbn00680  Methane metabolism
mbn00720  Carbon fixation pathways in prokaryotes
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
Module
mbn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mbn_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0673
   00020 Citrate cycle (TCA cycle)
    Mboo_0673
   00620 Pyruvate metabolism
    Mboo_0673
   00640 Propanoate metabolism
    Mboo_0673
   00650 Butanoate metabolism
    Mboo_0673
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0673
   00680 Methane metabolism
    Mboo_0673
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_0673
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mboo_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABS55191
UniProt: A7I630
LinkDB All DBs
Position
complement(641025..642179)
Genome map
AA seq 384 aa AA seqDB search
MLEITEGSMAVAEAVRLCRPQVVSAYPITPQTHIVEALAEMVANGKLDADYITVESEFSA
LSACLGASAAGSRTYSATTSQGLALMYEVCFNVAGMRLPIVMTIANRAMGAPLSIWNDQQ
DSISLRDSGWLQFYAEDNQEATDLHYIAYKVAENPTVQLPAMVCFDGFILSHTYEPVDMI
SQEDADKYLPKFSPKERLDAADPISFGMYATPEYYLEFRYEIDKAVKEAAVAIRAAGAEF
GKMFGRDYSALVEGYQLEDAETVIVAMGSICGTVKDTIDEMRKEGKKVGLLKIRVFRPFP
SEDVAKALKGAKHVAVLDKNISLGAKGATALEVKDALYGSGIPVYDYIIGLGGRDVRKKD
IREVVALAEKGKGDQFIGLRKEVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaatcaccgaaggctcgatggctgtcgccgaggcggtccggctctgccgcccg
caggtcgtctccgcgtacccgatcaccccccagacccacatcgtcgaagcgctcgccgag
atggttgcaaacgggaaacttgacgcggactacatcacggtcgagagcgagttctccgcg
ctctccgcctgccttggggcgagcgccgcgggatcccggacgtactccgccaccacctcg
cagggccttgccctgatgtacgaggtctgcttcaacgtggccggcatgcgcctgcccatt
gttatgaccattgccaaccgggccatgggcgccccgctctccatctggaacgaccagcag
gactcgatttccctgcgggactccggctggctccagttctatgccgaggacaaccaggaa
gcaaccgacctccactatatcgcctacaaggtagcggaaaaccccaccgtgcagctcccg
gcgatggtctgttttgacggatttattctctcgcatacgtacgagccggtggacatgatc
tcgcaggaggatgcggacaagtacctcccgaagttttcgccaaaggaacggctcgatgca
gccgaccccatcagtttcgggatgtacgcaacgcccgagtattaccttgagttccggtac
gagatcgacaaggccgtcaaggaagcagcggtcgcgatccgggcagcaggggccgagttc
gggaagatgttcggccgtgactacagcgctcttgtcgagggctaccagcttgaggatgca
gagaccgtgatcgttgccatgggttcgatctgcggtaccgtcaaggacaccatcgacgag
atgcgaaaagaaggaaagaaagtcgggcttctgaagatccgggtcttccgcccgttcccg
tcagaagatgtggcaaaggccctcaaaggcgcaaagcacgttgccgtgctcgacaagaac
atctcgcttggcgcgaaaggtgccaccgcactcgaagtaaaagacgcactctacggttcc
ggcatcccggtgtacgattacatcatcggacttggcggaagagatgtgcgcaagaaggac
atccgcgaggttgtcgcgcttgccgaaaaaggtaagggagatcagtttatcgggctgcgt
aaggaggtgctctaa

DBGET integrated database retrieval system