KEGG   Methanoregula boonei: Mboo_1537Help
Entry
Mboo_1537         CDS       T00578                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00500  Starch and sucrose metabolism
mbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mboo_1537
Enzymes [BR:mbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mboo_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: ABS56054
UniProt: A7I8J3
LinkDB All DBs
Position
1608255..1609709
Genome map
AA seq 484 aa AA seqDB search
MPEVCIGFEVHQPFRLNRHFSPDPKKKEKDLEALYFDELNREVLERVAEKCYLPATRIIL
DKLDEGFCCTFSFSGTLIEQLERWKPDVLSLFDQVARHKNSEILGQTYYHSIAGCFGDKS
EFIEQAGMHADLMYDQFKTRPNVFENTEFTFNNQIASCVKKMGYAGIFTEGVDRILDWRS
PHHIYSCNDLPVLLRDVQLSDDIAFRFGNQGWDKYPLTADTYAGWISGTTGDVVNIFLDY
ETFGEHFWKETGIFNFLSYLPEELEKRGVRTILPTEVLERYPPVGTIDVVDTISWADVEK
DVSAWMGNERQHTAYSAIQKAAAFAKDKTIWRYLQTSDHFYYMASKYGTCGEVHNYFSHH
EAEDAFKTYMSVLADFEKREVRFMKNKRSAKTLRTLTPEEAFHFASPSGYVGYAAYSLDQ
FCSLLKVVPSDSIAYHQERGDIAHWIEHVLSDQKLSGEINGITDRQELFTILDERRKLLW
SHLT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtctgtatcggatttgaagtgcaccagccattcaggctcaaccggcacttc
tcaccggatccaaagaagaaggaaaaggatctggaggcactctattttgacgaactcaac
cgtgaggttctggaacgggtggcagaaaaatgctacctgccggccacccggatcatcctg
gataaactggacgaaggattctgctgtacgttctccttttccggtacgcttatcgaacag
ctggaacggtggaagcctgatgtcctgtccctctttgaccaggttgcccggcataaaaat
tccgagatcctcgggcagacatactaccacagcattgccggctgttttggcgataaatcg
gaattcatcgagcaggccgggatgcatgccgacctgatgtacgatcagtttaagacccgt
ccgaatgtctttgagaataccgagttcacgttcaacaaccagatcgcctcctgcgtaaag
aagatgggatatgccgggatcttcaccgagggagtagaccggatccttgactggcgcagc
ccgcaccatatctattcctgcaacgatctgcccgtcctcctccgcgacgtccagctctcc
gacgatatcgcgttccggtttggcaaccagggctgggacaagtacccgctgactgcggat
acctatgccggctggatcagcggtacaacgggtgacgtggtaaacatcttccttgattac
gagacctttggcgagcatttctggaaagagaccgggatcttcaatttcctctcctacctt
cctgaagaactagaaaaacggggagtcaggacaatacttcccacggaagtcctggaacgt
tacccgccggtcggcacgattgatgtcgtggacactatctcctgggcagatgttgaaaag
gatgtgtcggcgtggatgggaaacgagcggcagcatacggcttattcggccatccagaaa
gcagctgcgtttgctaaggataagaccatctggcggtacctccagacaagcgaccacttc
tattacatggcctccaagtacgggacctgcggcgaagtgcacaactatttcagccaccac
gaggcagaggacgcatttaagacgtacatgtccgttcttgctgattttgagaaacgggag
gtccggttcatgaagaacaagcggtcggcaaagacgctgcggaccctgaccccggaagag
gcgttccatttcgcctcgccctcaggctatgtcgggtatgccgcatacagcctcgaccag
ttctgcagtctgctcaaggtagtaccttcagattcgatcgcctaccaccaggagcgggga
gatatcgcgcactggatcgaacatgtcctttcagaccagaaattatccggggagatcaac
ggcattacagaccggcaggagctctttacgatacttgacgagaggaggaaactgctatgg
agtcacttaacgtag

DBGET integrated database retrieval system