KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB0253CHelp
Entry
BQ2027_MB0253C    CDS       T00132                                 

Definition
(RefSeq) PROBABLE SUCCINATE DEHYDROGENASE [IRON-SULFUR SUBUNIT] (SUCCINIC DEHYDROGENASE)
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo00020  Citrate cycle (TCA cycle)
mbo00190  Oxidative phosphorylation
mbo00650  Butanoate metabolism
mbo01100  Metabolic pathways
mbo01110  Biosynthesis of secondary metabolites
mbo01120  Microbial metabolism in diverse environments
mbo01130  Biosynthesis of antibiotics
mbo01200  Carbon metabolism
Module
mbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BQ2027_MB0253C
   00650 Butanoate metabolism
    BQ2027_MB0253C
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BQ2027_MB0253C
Enzymes [BR:mbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BQ2027_MB0253C
    1.3.5.4  fumarate reductase (quinol)
     BQ2027_MB0253C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 Fer4_16 Thioredoxin_7 Fer2_4 Fer4_10
Motif
Other DBs
NCBI-GeneID: 1091018
NCBI-ProteinID: YP_009357583
Pasteur: Mb0253c
LinkDB All DBs
Position
complement(296441..297187)
Genome map
AA seq 248 aa AA seqDB search
MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDVSFNYQKAREIPSFAPP
KELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEENKDAFAGPRFLMRIAELE
MHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGSKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacagcgcgagtatgcgggtgtggcgcggagacgaaagctgtggcgaactccgc
gaattcaccgtggaggtcaacgagggcgaggtcgtgctggacgtcatcctccgtctacaa
cagacgcagacaccggatctcgcagtgcgctggaattgcaaagctggcaagtgcggatcc
tgctcggccgagatcaacggcaaaccgcgactgatgtgcatgacgcggatgtcgacattc
gacgaggacgagatcgtcacggtcaccccaatgcggacgtttccggtgattcgcgatctt
gttaccgacgtctcgttcaactaccaaaaagcgcgcgagatcccgtctttcgcgccaccc
aaggagctacagcccagcgagtaccgaatggcgcaagtcgacgttgcacgctcgcaggag
ttccgcaagtgcattgaatgcttcctgtgccaaaacgtctgccacgtagttcgcgatcac
gaggaaaacaaggatgcgttcgccggcccccgcttcctgatgcgaatcgccgaactcgaa
atgcatccgctggacacccgggaccgacgcagccaagcacaggaagagcacggcctgggc
tactgcaatatcaccaagtgctgcaccgaagtgtgcccagaaaacatcaagatcaccgac
aatgccctgatcccgatgaaagaacgggtcgccgaccgcaagtatgatccggtggtatgg
ctgggcagcaagctgtttcgccgctaa

DBGET integrated database retrieval system