KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB0254CHelp
Entry
BQ2027_MB0254C    CDS       T00132                                 

Definition
(RefSeq) PROBABLE SUCCINATE DEHYDROGENASE [IRON-SULFUR SUBUNIT] (SUCCINIC DEHYDROGENASE)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo00020  Citrate cycle (TCA cycle)
mbo00190  Oxidative phosphorylation
mbo00650  Butanoate metabolism
mbo01100  Metabolic pathways
mbo01110  Biosynthesis of secondary metabolites
mbo01120  Microbial metabolism in diverse environments
mbo01130  Biosynthesis of antibiotics
mbo01200  Carbon metabolism
Module
mbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BQ2027_MB0254C
   00650 Butanoate metabolism
    BQ2027_MB0254C
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BQ2027_MB0254C
Enzymes [BR:mbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BQ2027_MB0254C
    1.3.5.4  fumarate reductase (quinol)
     BQ2027_MB0254C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 1091017
NCBI-ProteinID: YP_009357584
Pasteur: Mb0254c
LinkDB All DBs
Position
complement(297188..299128)
Genome map
AA seq 646 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD
QGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR
LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAEAIDAAAQQALSPFEGPKDGSA
PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWSRYHNVLVEGHRQYNPGWNLS
IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRRILLVCRATETMGTGGSGSG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgagcggcactcctacgacgtagtcgtgatcggtgccggcggcgcgggg
ttacgcgcggtcatcgaggcgcgggaacgcggcttgaaagtagccgtcgtgtgcaaatcc
ctattcggcaaggcccacacggtcatggccgaaggcggctgcgcggccgcgatgggcaac
gccaacccgaaggacaattggaagactcacttcggcgacacgatgcgcggtggaaagttc
ctgaacaactggcgtatggccgagctgcacgccaaggaggcgccggaccgggtctgggag
ttggagacctacggcgcgctgttcgaccgcaccgacgatggccgaatcagtcagcgcaac
ttcggcggacacacctatccgcgactggcgcacgtcggcgaccgcaccggcctggagttg
atccgcaccctgcagcaaaaggttgtctcgctgcagcaggaggaccacgccgagctcggc
gactacgaagcgcggatcaaagtgttcgccgaatgcaccatcaccgaactgctcaaggac
caaggcgcgatcgccggagccttcggctactggcgggaaagcggccggttcatcgtgttc
gaggcgccagcggtggtgcttgccactggcgggatcggcaagtcgttcaaggtgacatcc
aactcctgggagtacaccggagacgggcacgcgttggcactgcgggccggggcgacgctg
atcaacatggagttcgtccagttccacccgacgggcatggtgtggccgcccagtgtcaag
ggaattctggtcactgagggtgttcgcggcgacggcggagtgctcaaaaactcggagaac
tctcgcttcatgttcgactacattccgccggtgttcaagggccagtacgccgagacggag
gaagaggccgaccagtggcttaaggacaacgactcggcccgacgcaccccggacttgctg
ccccgcgacgaggtcgcgcgcgcgatcaactcagaggtcaaggccggccgcggtaccccg
cacggcggcgtctacctcgacatcgcatcccggctgacacccgccgagatcaaacggcga
ttgccgtcgatgtatcaccagttcaaagagctcgctgaagtcgatatcacaacgcaggca
atggaagtcgggccgacgtgtcactacgtgatgggcggtgtcgaagtagacgcggacacc
ggcgccgccacggtgccaggcctgttcgctgccggtgagtgtgccggcggtatgcacggc
tccaaccggctgggcggcaattcgctgtccgatctgctggtattcggccggcgggccggc
ctgggcgcagcggattacgtacgggcactgagcagccggccagcggtttcagcggaggct
atcgatgcggcggcccagcaggcgctgagccccttcgaaggaccgaaagacggctcggcg
ccggagaatccgtacgcgctgcatatggacttgcagtacgtgatgaacgatctggtcggt
atcatccgcaacgccgacgaaatatccagggcgctgactcttttggccgagctgtggtcg
cgctaccacaacgtactcgtcgaaggtcaccgtcaatacaatccgggctggaacctgtcc
atcgacctgcgcaacatgttgctggtcagcgagtgcgtggccagagctgcgctacagcgc
accgaaagccgaggcggccacacccgagacgaccatcccggtatggaccccaactggcgc
aggatcttgctggtatgccgggccaccgaaaccatgggcaccggtggcagcgggtccggc
gactccaactgccacatcaacgtcacccagcagctgcaaacgcccatgcgacccgacttg
ctggagctcttcgagatctcggagttggagaaatactacaccgacgaagagctggccgag
catccaggacggagaggctaa

DBGET integrated database retrieval system