KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB1312CHelp
Entry
BQ2027_MB1312C    CDS       T00132                                 

Gene name
oppD
Definition
(RefSeq) PROBABLE OLIGOPEPTIDE-TRANSPORT ATP-BINDING PROTEIN ABC TRANSPORTER OPPD
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Pathway
mbo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mbo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BQ2027_MB1312C (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mbo02000]
    BQ2027_MB1312C (oppD)
Transporters [BR:mbo02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BQ2027_MB1312C (oppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_29 AAA_16 AAA_33 NACHT RsgA_GTPase PRK MMR_HSR1 T2SSE FtsK_SpoIIIE AAA_30 Mg_chelatase DUF87 TrwB_AAD_bind
Motif
Other DBs
NCBI-GeneID: 32288427
NCBI-ProteinID: YP_009358650
Pasteur: Mb1312c
LinkDB All DBs
Position
complement(1435988..1437826)
Genome map
AA seq 612 aa AA seqDB search
MSPLLEVTDLAVTFRTDGDPVTAVRGISYRVEPGEVVAMVGESGSGKSAAAMAVVGLLPE
YAQVRGSVRLQGTELLGLADNAMSRFRGKAIGTVFQDPMSALTPVYTVGDQIAEAIEVHQ
PRVGKKAARRRAVELLDLVGISQPQRRSRAFPHELSGGERQRVVIAIAIANDPDLLICDE
PTTALDVTVQAQILDVLKAARDVTGAGVLIITHDLGVVAEFADRALVMYAGRVVESAGVN
DLYRDRRMPYTVGLLGSVPRLDAAQGTRLVPIPGAPPSLAGLAPGCPFAPRCPLVIDECL
TAEPELLDVATDHRAACIRTELVTGRSAADIYRVKTEARPAALGDASVVVRVRHLVKTYR
LAKGVVLRRAIGEVRAVDGISLELRQGRTLGIVGESGSGKSTTLHEILELAAPQSGSIEV
LGTDVATLGTAERRSLRRDIQVVFQDPVASLDPRLPVFDLIAEPLQANGFGKNETHARVA
ELLDIVGLRHGDASRYPAEFSGGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIIN
LLLDLQEQFGLSYLFVSHDLSVVKHLAHQVAVMLAGTVVEQGDSEEVFGNPKHEYTRRLL
GAVPQPDPARRG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgagccccctgctcgaggtgaccgatttggccgtcaccttcaggaccgatggcgatccg
gtgaccgcggtgcgcgggatcagctaccgcgtcgagcccggcgaggtggtcgcgatggtg
ggcgaatcgggttcaggtaagtccgcagcggcgatggcggtggtgggcctgctgcccgag
tacgcgcaggtgcgtggttcggttcggctacagggtaccgaactgttggggcttgccgac
aacgcgatgtcccggtttcgaggcaaggcgatcggcacggtgttccaggatccgatgtct
gcgctcacccctgtctacaccgtcggcgaccaaatcgccgaggccatcgaggtgcaccag
ccccgtgttggcaagaaggccgctcgtcggcgtgcggtggaactgcttgacctggtcggt
atttcgcagccgcagcggcgttcccgtgcgtttccgcatgagctttcaggtggcgaacgc
caacgcgtggtgatcgccatcgcgatcgccaacgatcccgacctgttgatctgtgacgaa
ccgaccacggcgctcgacgtcacggtgcaggcgcagatcctcgacgtcctcaaggcggcg
cgcgacgtcaccggcgccggggtgctgatcatcacccacgacctcggcgtcgtggccgag
ttcgccgaccgggcgctggtgatgtacgccggacgggtcgtcgagtcggccggggtgaat
gatctgtaccgcgatcgccggatgccctacaccgtggggcttttaggctcggtcccccgg
ctggatgccgcgcagggcacccggctggtgccgataccgggtgcgcccccgtcgctggcg
ggcttggcaccgggttgcccgttcgcgccgcgctgcccgctagtcatcgacgaatgcctt
accgcggaacccgaattgcttgacgtcgctaccgatcaccgggcggcctgcatccgcacc
gagctggtcaccgggcgcagcgccgccgacatctaccgggtcaaaaccgaggcccgcccg
gctgcactcggcgacgcctcggtggtcgtgcgggtacgtcatctagtcaaaacctaccgg
ctggccaagggcgtggtgctgcgccgggcgatcggcgaggtccgcgcggtcgacggcatc
agtctcgaactccggcagggccgcacgttgggtatcgtcggcgaatccggttcgggcaag
tcgaccaccctgcacgagatcctggagctggctgcgccgcaatcgggatcgatcgaagtc
ctcggcactgacgtcgccacgctggggacagcggaacgccgatcgctgcgccgcgacatc
caggtggtcttccaagacccggtggcgtccttagacccgcggctgccggtcttcgatctg
attgccgaaccattgcaggccaatgggttcggcaagaacgagactcacgcgcgggtcgcc
gagctgctcgatatcgtcggactgcgccacggcgacgccagtcgttatcccgccgagttc
tccggcggtcagaagcagcgcatcggcatcgcgcgggcactggcgctccaacccaagatc
ctggcactcgacgaaccggtgtcggcactcgatgtctccattcaggccgggatcatcaac
ctgctgctcgacctccaagagcagttcgggttgtcatatttatttgtttcccacgatctt
tcggtggtcaaacacctcgcccaccaggtggcggtcatgcttgccggtaccgttgttgag
cagggcgacagtgaggaggtcttcggcaatccgaaacacgagtacaccaggcgactgctg
ggcgcggtaccgcaaccggatccggcccgtcgtggctga

DBGET integrated database retrieval system