KEGG   Mycobacterium tuberculosis variant bovis AF2122/97: BQ2027_MB3876Help
Entry
BQ2027_MB3876     CDS       T00132                                 

Gene name
sodA
Definition
(RefSeq) SUPEROXIDE DISMUTASE [FE] SODA
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mbo  Mycobacterium tuberculosis variant bovis AF2122/97
Brite
Enzymes [BR:mbo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BQ2027_MB3876 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 32288277
NCBI-ProteinID: YP_009361240
Pasteur: Mb3876
LinkDB All DBs
Structure
PDB: 

Position
4261389..4262012
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYAAATSQTKGLTFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacaccttgccagacctggactgggactacggagcactggaaccgcacatc
tcgggtcagatcaacgagcttcaccacagcaagcaccacgccacctacgtaaagggcgcc
aatgacgccgtcgccaaactcgaagaggcgcgcgccaaggaagatcactcagcgatcttg
ctgaacgaaaagaatctagctttcaacctcgccggccacgtcaatcacaccatctggtgg
aagaacctgtcgcctaacggtggtgacaagcccaccggcgaactcgccgcagccatcgcc
gacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgctaccaccgtg
caggggtcgggctgggcggcactgggctgggacacactcggcaacaagctgctgatattc
caggtttacgaccaccagacgaacttcccgctaggcattgttccgctgctgctgctcgac
atgtgggaacacgccttctacctgcagtacaagaacgtcaaagtcgactttgccaaggcg
ttttggaacgtcgtgaactgggccgatgtgcagtcacggtatgcggccgcgacctcgcag
accaaggggttgacattcggctga

DBGET integrated database retrieval system