KEGG   Moraxella bovis: DQF64_03985Help
Entry
DQF64_03985       CDS       T05535                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
mboi  Moraxella bovis
Pathway
mboi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mboi01100  Metabolic pathways
mboi01110  Biosynthesis of secondary metabolites
mboi01130  Biosynthesis of antibiotics
mboi01230  Biosynthesis of amino acids
Module
mboi_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:mboi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DQF64_03985
Enzymes [BR:mboi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     DQF64_03985
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     DQF64_03985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT MtrA GTSE1_N DUF5082 Cep57_CLD_2
Motif
Other DBs
NCBI-ProteinID: AWY19739
UniProt: A0A2Z4R603
LinkDB All DBs
Position
763706..764818
Genome map
AA seq 370 aa AA seqDB search
MSKQTHKANLDTNQITDLRGKIDSIDEQIQRLINERASIAQQVAIAKKNHENHPIFYRPE
REAQVLKAVMARNTGPLSGEKMARLFREIMSVCLELEAPQKVAFLGPVGTFTHAAALKHF
GKAATTVPLATITDVFREVEAGSAMYGVVPVENSSEGVVNHTLDAFLGSSLKIIGEVELP
IHHNFLVAEHTKVDSLSRIYSHQQSLAQCRHWLDANFPNVERVAVSSNGEAAKRLQNEWH
SAAIAGDVAVAEYGLHKLFENIEDNPNNTTRFLIIGHETVAPSGQDKTSIVVSSPDRAGA
LIELLEPLKKHGVSMTSIETRPERPNKWAYVFFIDMTGHIADDNVKNAIEDIAKIAKDVR
VLGSYPKAVI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaaacccacaaagccaacctagacaccaaccaaattaccgatttgcgtggc
aagattgacagcattgatgagcaaattcaacgacttatcaacgagcgagccagcattgcc
cagcaagtcgccatcgccaaaaagaaccacgagaatcaccccattttttatcgccccgaa
cgtgaagcccaagtgctaaaagcagtcatggcaagaaacacaggccccctatcgggcgag
aaaatggcacgcctgtttcgggagattatgtcggtgtgcctagaacttgaagctccacaa
aaggtcgcctttttggggcctgttggtacgtttacccatgccgccgccctaaaacatttt
ggtaaggcagcgaccaccgtgccacttgccacgattaccgatgtctttcgtgaagtggag
gcaggctctgccatgtatggcgtggtgcctgtggagaactcgtccgaaggcgtggtcaat
catacgttggacgcatttttggggtcaagcctaaaaatcatcggcgaggtggaactgccc
attcatcacaactttttggtggcagaacacaccaaagtggacagcctaagtcgcatttat
agccaccagcagtcgcttgcccagtgccgtcactggcttgacgccaatttccccaatgtc
gagcgagtggcggtgtcatctaatggcgaagctgctaaacgcctacaaaacgaatggcac
tcagcagcgattgcgggtgatgtggcggtggctgaatacggcttgcataaactttttgag
aacattgaggacaatcccaacaataccactcgttttcttatcatcggacacgaaaccgtt
gccccaagcggtcaagacaaaacgtccatcgtggtgtccagcccagaccgtgcaggagcg
ttgattgagctactagaacctctaaaaaaacatggcgtatccatgacgagcattgagacc
cgccctgagcgtccgaacaaatgggcatatgtgttttttatcgacatgacggggcatatc
gctgacgacaacgtcaaaaacgccattgaggacatcgctaaaatcgccaaagatgtgcgg
gtattggggtcatatccaaaggcggtgatttga

DBGET integrated database retrieval system