KEGG   Moraxella bovis: DQF64_11020Help
Entry
DQF64_11020       CDS       T05535                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mboi  Moraxella bovis
Pathway
mboi00473  D-Alanine metabolism
mboi00550  Peptidoglycan biosynthesis
mboi01100  Metabolic pathways
mboi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mboi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DQF64_11020
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DQF64_11020
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DQF64_11020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mboi01011]
    DQF64_11020
Enzymes [BR:mboi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DQF64_11020
Peptidoglycan biosynthesis and degradation proteins [BR:mboi01011]
 Precursor biosynthesis
  Amino acid ligase
   DQF64_11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp ATP-grasp_3 CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: AWY20961
UniProt: A0A2Z4RBQ8
LinkDB All DBs
Position
complement(2158120..2159028)
Genome map
AA seq 302 aa AA seqDB search
MNDVTKFGKVAVVCGGFSAEREVSLNSGRAVLNALLLKGVDAHHFDPQETDISNLREYDR
VFNVLHGTFGEDGSLQGVLDGFKIPYTGCGVLASAIAMDKFRCRLVWQSLGLPNVPYVVL
HDDSDFDAVEADFGLPLFVKPASEGSSVGVMMIEETGGLAKAYPKLKQYHGEILAEKAIT
GGEYACSLLGDDVLPSIRIIPKGKFYDYEAKYLRDDTVYQCPSDLTAEQEREMGELAKRA
FSAMGGRGWSRVDFLKSDDGKLYVLEINTVPGMTDHSLVPMAAKEAGIEFADLCVKILEQ
TL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgtaacaaaatttggcaaagtcgctgtggtttgcggtgggtttagtgccgag
cgtgaagtgtctttaaatagtggcagggcggtgctaaatgccctgcttttaaaaggtgtg
gacgctcatcattttgacccacaagagaccgacatttcaaacttgcgtgagtatgaccgt
gtgtttaatgtcttgcatggcacttttggcgaagatggtagtttgcaaggcgtgcttgac
ggctttaagattccttatacaggttgtggcgtgctagcatccgccattgccatggataag
tttcgttgccgtttggtgtggcagtcgctaggcttgccgaatgtgccttatgtggtgttg
cacgatgacagcgattttgatgcggtggaggcagactttggcttaccgttatttgtcaaa
cccgccagtgagggttctagtgtgggtgtgatgatgatagaagagacaggcggtttggca
aaggcgtatcctaagctaaaacagtatcatggcgagattttggcagaaaaagcgattaca
gggggcgagtacgcctgttcgttacttggcgatgatgtcttgccgagtattcgcattatc
cctaagggcaagttttatgactatgaagccaaatacctgcgtgatgacacggtgtatcaa
tgcccgtctgacttaactgccgaacaagagcgtgaaatgggcgagcttgccaaacgtgct
ttttctgccatgggtgggcgtggctggtctcgtgtggactttttaaaatctgatgacggc
aagctgtatgtcctagaaatcaataccgtgccgggtatgaccgaccatagccttgtgcca
atggcagccaaagaagcggggattgaatttgcggatttgtgtgtgaagattttagaacag
acgttataa

DBGET integrated database retrieval system