KEGG   Moraxella bovis: DQF64_13040Help
Entry
DQF64_13040       CDS       T05535                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mboi  Moraxella bovis
Brite
KEGG Orthology (KO) [BR:mboi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DQF64_13040 (ahpF)
Enzymes [BR:mboi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DQF64_13040 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored NAD_binding_8 AlaDh_PNT_C FAD_binding_2 DAO Thi4 NAD_binding_7 Glutaredoxin NAD_binding_9 FAD_binding_3 K_oxygenase 3HCDH_N Lycopene_cycl Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AWY21330
UniProt: A0A1S9ZXY9
LinkDB All DBs
Position
2568739..2570295
Genome map
AA seq 518 aa AA seqDB search
MLDKSLLDAIKTYSTNMTRPIAMILGYGDHAKRAELVNFLEQIASCSDKIGFDKTVVDID
LSPMSFKITTDNRDTGIVFSGIPGGHEFTSLLLAILHAGGHTMKLDEGIQELVKRIQKPL
KFQTFVSLSCHNCPDVVQALNQFAILNEGIENEMIDGGVFPELVEANNIQGVPAVFLNGK
PFLNGKVDTARIIDKLQAEYPDLLAEGQSEELETQDVTVIGGGPAGSAAAIYTARKGLRV
ALVADRIGGQVKDTQDIENLISIPLTNGNTLASNLATHIKEYNITVKEHVSVSSIEEVKG
GYQVTLNTGASWTSSTLIIATGAKWRKLGVKGEDENIGNGVAYCPHCDGPFFKGKPVAVI
GGGNSGVEAALDLAGIVAHVTVLEFGDKLRADQVLIDKASAKDNITIIKNATTQKITANG
GKVDGLIYQDRVSGENVTLPLSAVFVQIGLVPNSDVVKGLVDVTAHGEIEIDAKCRTSKA
GVFACGDVTTVPYKQINIAMGEGSKAGLSAFEYLMMNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctagacaaatctttacttgatgctatcaagacttacagcaccaacatgacccgcccc
attgccatgattttgggttacggcgaccatgccaaacgtgccgaattggtgaactttttg
gagcagattgccagctgctcggataaaatcggctttgacaagactgtggtggatattgac
ttatcgcccatgagctttaagattaccaccgacaaccgtgatacgggcattgtgtttagt
ggcatcccaggcggtcatgagttcacgtccttgctacttgcgattttgcacgcaggcggt
cataccatgaagctggacgaaggcattcaagagctggttaaacgcattcaaaaaccactt
aaatttcaaacctttgtctcgctatcgtgccacaactgccctgatgtcgtgcaagcgtta
aaccaatttgccatcttaaatgaaggcattgaaaacgagatgattgacggtggcgtattc
cccgagcttgtcgaagccaacaacattcaaggcgtgcctgcggtatttttaaacggcaaa
ccatttttaaatggtaaagtcgataccgcccgtatcattgacaaactacaagccgagtac
cccgacttacttgccgaaggtcaaagcgaagagctagaaacccaagacgtaaccgtcatc
ggtggtggacctgctggcagtgcggcggcgatttataccgctcgcaagggacttcgtgtg
gcactcgttgccgaccgtattggcgggcaagttaaggatacccaagacattgagaactta
atctcaatcccactcaccaacggcaacaccctagcaagcaaccttgccacacatattaaa
gaatacaacatcacggtcaaagaacacgtgagcgtatcgtctatcgaagaagtcaaaggc
ggttatcaagttaccctaaacacaggggcaagttggacttcaagcacgctcatcattgcc
acaggagccaaatggcgtaaacttggtgtcaaaggcgaagatgaaaacatcggcaacggc
gtggcgtattgcccacactgcgatggccccttctttaagggcaagcctgtggcggtcatc
gggggcggtaactcgggcgtggaagcggcgttggacttggcgggtatcgttgctcacgtt
accgtgttagagtttggcgataaactacgtgccgaccaagtcctgattgacaaagcgagt
gccaaagacaacatcacaatcatcaaaaacgccaccacgcagaaaatcacggcaaatggc
ggtaaagtagatggtcttatctatcaagaccgagtgtcgggcgagaatgtaactttgcca
ctatcggcggtatttgtgcaaatcggactggtgccaaactctgatgtcgtcaagggcttg
gtcgatgttaccgctcatggcgagattgagattgatgccaaatgtcgcacgagcaaggca
ggcgtgtttgcttgtggggacgtaaccaccgtaccttataagcaaatcaacattgccatg
ggcgaaggctcaaaggcagggctgtcggcatttgagtatttgatgatgaattcttga

DBGET integrated database retrieval system