KEGG   Mycoplasma bovigenitalium: MBVG596_0809Help
Entry
MBVG596_0809      CDS       T05188                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
mbov  Mycoplasma bovigenitalium
Brite
KEGG Orthology (KO) [BR:mbov00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MBVG596_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAW18413
UniProt: A0A1L7MYX0
LinkDB All DBs
Position
complement(570668..571717)
Genome map
AA seq 349 aa AA seqDB search
MKNTNKEKIYTGLELKKLKKAYRKSNKKSLISKNIIPNESKGWVIVETIIKWFIKIILLV
STPKDSWKNKNKSRELIDRTYSKFISSDSVFIPISLSFYFLVSFVPILTVLVLLLSFISD
YSTIFIDVILDRIIPGLKQVIKMPQVGPSTGFQYTTITLLLLTSTWIGSNGWGRFIYLQN
YIYGHESLGNFFINRIKGFLIVLSITLYLFIMSVIYIYFYKIFSLEFDSTSEKTFFYITF
YIYLIFVVYIGFTLLFKFSPSFKLTWNSVLPGVLIAAIPNILFISSFGFLSTQIDYKKYG
TIGTFMYIALFVSSIAYFLFLGLIVNESYYKTYYSSFTIAKNQLFRKRV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatacaaataaggaaaaaatttatacgggtttagaacttaaaaaacttaaaaaa
gcctaccgaaaaagtaataaaaaatcattaatttcaaaaaatataatacctaacgaatca
aaaggttgggttattgtagaaacaataattaaatgatttataaaaataatattgcttgtt
tccacaccaaaagacagttgaaaaaacaaaaataaaagtcgcgaactcatagatagaact
tattcaaaattcatttcttcagattcagtatttattcctatttccttgtcattttatttc
ttggtatcatttgtgccaattttaactgttttagtgttgctactttcatttatttctgat
tattcaactatatttattgatgttattttagatagaataattcctggcttaaaacaagtt
ataaaaatgccgcaagtgggtcctagcactggatttcaatatacaacaataacactgctg
ctactaacatcgacttgaattggttcaaatggatgaggaagatttatatatctacaaaat
tacatttatggacatgaatcattaggtaacttttttataaatagaattaagggtttctta
attgttctttcgataacgctttacctttttattatgtctgtaatttacatttatttttat
aaaatttttagccttgaatttgattcaacatcagaaaaaacatttttctatatcacattt
tatatctatttaatttttgttgtatacattggttttacactattattcaaattttctcct
tcgtttaaacttacttgaaattcagtattaccaggcgtgcttattgctgctatacctaac
attttattcatctcatcttttggatttttatctactcaaattgattataaaaaatacggc
acaattggcacttttatgtatattgcattgtttgtttcgtctattgcatatttcttattt
ttaggcttaatagtgaatgaatcatattataaaacttactattcttcattcactattgca
aagaatcaattatttagaaagagggtttaa

DBGET integrated database retrieval system