KEGG   Monosiga brevicollis: MONBRDRAFT_21418Help
Entry
MONBRDRAFT_21418  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00330  Arginine and proline metabolism
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MONBRDRAFT_21418
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbr04147]
    MONBRDRAFT_21418
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     MONBRDRAFT_21418
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   MONBRDRAFT_21418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 5890130
NCBI-ProteinID: XP_001745072
JGI: 21418
UniProt: A9UWZ8
LinkDB All DBs
AA seq 357 aa AA seqDB search
MVDECSPSSTRPARPLHLTVDVYEQLKDKITPNGFTLERAIQSGVDNPDSGVGLYAGDEE
CYSVFGPLFDAVIEDYHGGYKPSDKHVSDLDAAKLKGTVDPEGKYVLSTRIRVGRNIRGL
GLSPGCSRAQRREVESLVTKGLANLKGDLAGKYFPLNGMSEADRKQLVADHFLFKKGDRF
LESAGANRDWPEGRGIFHNNEKTFLVWVNEEDQMRIISMQSGGDAKQVFERLVRGISAIE
EQVKAAGREFAHNDHLGYIHSCPTNCGTGMRASVHVQLPKVGAHPNFKKWCAKLRLQPRG
IHGEHSESDGGVYDLSNKERLGKSEVQLVQTMIDGVNTLIAAEKALAEGKPLPSELQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgagtgcagcccaagctctacccgccctgcacgcccgctccatctgaccgtt
gacgtctacgagcagctcaaggacaagattacgcccaacggcttcactcttgagcgtgcc
atccagtcaggcgtggacaatcccgattccggcgtgggcctatatgctggtgacgaagag
tgctactcggtcttcggcccgctgttcgacgcggttatcgaggactatcacggcggctac
aagccctcagacaagcacgtgtcggaccttgacgccgccaagctcaagggcaccgttgac
cccgaaggcaaatacgtgctctcgactcgcatccgtgtgggccgcaacattcgtggtctc
ggtctctcccctggctgttcgcgtgctcagcgccgtgaggtcgagtcactcgtcaccaag
ggtctcgccaatctcaagggcgacctggctggcaagtacttccctctcaacggcatgagc
gaggcggaccgcaagcagctggtggctgaccacttcctcttcaagaagggcgaccgcttc
ctggagtcggctggtgccaaccgcgactggccagagggccgtggcatcttccacaacaac
gagaagaccttcctcgtctgggtcaacgaggaggatcaaatgcgtatcatttccatgcaa
agcggcggtgacgccaagcaggtctttgaacgcctggtgcgcggtatcagtgccattgag
gagcaagtcaaggcagcgggccgtgagtttgcccacaacgatcatctcggctacatccat
agctgccccaccaactgcggtactggcatgcgtgcctccgtgcacgtgcagcttcccaag
gtcggcgcccaccccaactttaagaagtggtgcgccaagcttcgcctccagccccgtggc
attcacggtgagcacagcgagagtgacggcggtgtttacgatctctccaacaaggagcgt
ctcggcaagtcggaggtgcagctcgtgcagaccatgatcgatggtgtcaacaccttgatt
gctgccgagaaggccctggccgagggcaagcctctgccttcggagctgcagtaa

DBGET integrated database retrieval system