KEGG   Monosiga brevicollis: MONBRDRAFT_24474Help
Entry
MONBRDRAFT_24474  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K04513  Ras homolog gene family, member A
Organism
mbr  Monosiga brevicollis
Pathway
mbr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MONBRDRAFT_24474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mbr04131]
    MONBRDRAFT_24474
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbr04147]
    MONBRDRAFT_24474
   04031 GTP-binding proteins [BR:mbr04031]
    MONBRDRAFT_24474
Membrane trafficking [BR:mbr04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    MONBRDRAFT_24474
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MONBRDRAFT_24474
  Exosomal proteins of other body fluids (saliva and urine)
   MONBRDRAFT_24474
  Exosomal proteins of colorectal cancer cells
   MONBRDRAFT_24474
  Exosomal proteins of bladder cancer cells
   MONBRDRAFT_24474
GTP-binding proteins [BR:mbr04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    MONBRDRAFT_24474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB
Motif
Other DBs
NCBI-GeneID: 5890368
NCBI-ProteinID: XP_001744985
JGI: 24474
UniProt: A9UWI5
LinkDB All DBs
AA seq 194 aa AA seqDB search
MASPSLRKKLVIVGDGACGKTCLLIVFAKDQFPEVYVPTVFENYVADIEVDGKAVELALW
DTAGQEDYDRLRPLSYPDTHVLLLCFSIDAPDSLENIQYKWKPEVEHFCPGVPYVLVGCK
RDLRQDPSTIRELQKLGQKPIPEDKGQSVAKVIGAYGYVECSAKTTENVRSVFEMATRAS
MAVRTRKRGGCALL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgccgagcttgcggaagaagcttgttattgtgggtgacggtgcctgtggaaag
acatgtcttcttatcgtctttgccaaggatcagtttccagaggtatacgtgcccaccgtc
tttgaaaattacgtggctgacattgaagttgatggcaaggccgttgagctggccctatgg
gacaccgctggccaggaagactacgatcggttgcgcccgctctcctatccagatacccac
gtcttgctcctctgtttcagcattgacgcccccgatagcctggagaatatccagtacaag
tggaaaccagaggtcgagcacttttgcccaggcgtcccatatgtgctcgtgggctgcaag
cgtgacctccgtcaggatcccagcacgattcgtgagcttcaaaagctgggtcaaaagccc
attcctgaagacaagggccagagcgtagccaaggtcatcggcgcctacggctacgttgag
tgctcagccaagacgacggagaacgtgcgtagcgtgtttgaaatggccacgcgcgctagc
atggcggtgcgcacccggaaacgcggcggctgtgccctgctctag

DBGET integrated database retrieval system