KEGG   Monosiga brevicollis: MONBRDRAFT_28221
Entry
MONBRDRAFT_28221  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K09850  Ras association domain-containing protein 1
Organism
mbr  Monosiga brevicollis
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2
Other DBs
NCBI-GeneID: 5893880
NCBI-ProteinID: XP_001748641
JGI: 28221
UniProt: A9V7J7
LinkDB
AA seq 421 aa
MPVAPAALEKLLLRRELASAHPRAGAGPTIATLRLNRPPNPQRFGHQQKQQPQCHPPTFL
SQQNRALPHLPACSAPPQTHDFEPHDVKLPTCRLERSIASVSSISSILSSQDEGTTTEQQ
RAHPKASQPDVQVGGHGLLSYLSAADIRAKINEFNATATDEQLELLDEVGDDKSFKGYIR
VTLNLTRPIRVSRGDLSISISPENTDTTGSPEASLPSPGIGPSRFFRTGSGGGSGPYTPS
SAAFDADTSFFLPKEVSKGLHVTSATTSQEVISILLRKFKVVSNPRKFALYEMNLLTGEK
RRLRRFEEPLALKLLWGGKNRDLILSLEEYNKDQHFRWEEFTDTELHNFLRILEEEEQAA
VCVVTASYDKRRAELQRQISIGSYPKIDFIHSQPTIVNLRRVISSMACPILRLRRNLITS
P
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcccgtcgctcccgctgctttagaaaagctcctgctgcgccgggaactagcgagcgcc
caccctcgcgctggcgccgggccaacaatagcaacacttcgattaaaccgccccccgaac
ccccaaagatttggacatcaacaaaagcaacaaccccagtgccacccccccacctttctc
agccaacaaaaccgcgctctccctcacttgcccgcttgctccgcgccgccgcagacccac
gactttgagccccacgatgtcaagctcccaacttgtcgcctcgagcgtagcattgcctcc
gtttcctccatcagctccatcctcagctcgcaagacgaaggtaccaccaccgagcagcaa
cgcgcgcaccccaaagcctcgcagcccgacgtacaggtgggcggccatggcctcctctcc
tatctctccgccgctgacatccgtgccaaaatcaacgaattcaacgccaccgccaccgat
gaacagctagagcttctggatgaagtgggtgatgacaagagcttcaagggttatattcgc
gttaccctcaacctgacccgccccattcgtgtctcgcgcggagacttgagcatcagcatc
tcacccgagaacacggacacaacgggcagccccgaagccagtctaccctcccccggaata
ggcccgtcccgcttctttcgaaccggttctggcgggggcagtggcccttacaccccgtcg
agcgccgcctttgacgccgatacctccttcttcttgcccaaagaggtttccaagggtctg
catgtcacgagtgccaccacctcgcaagaagtcatttcaatcctgctccgcaagttcaag
gtcgtcagcaaccctcgaaagtttgccctctacgaaatgaaccttctcaccggagaaaaa
cgtcgtctccgacgattcgaagaacccttggccctcaaactcctttggggcggcaagaac
cgcgatctcatcctctcgctcgaagagtacaacaaagaccaacattttcgctgggaggag
tttaccgacacggagctgcacaactttttgcggatccttgaagaggaagagcaggctgcc
gtctgcgtcgtgacggccagctacgataagcgccgtgccgagttacaacgccaaatcagc
attggctcctatcctaaaatcgattttattcacagtcaaccaacgatagtcaacctacga
cgagtcatttccagcatggcatgtccaatcctgcgcctgcgccgcaatctgatcacatcc
ccatga

DBGET integrated database retrieval system