KEGG   Monosiga brevicollis: MONBRDRAFT_28715Help
Entry
MONBRDRAFT_28715  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 5894396
NCBI-ProteinID: XP_001749157
JGI: 28715
UniProt: A9V8Z4
LinkDB All DBs
AA seq 327 aa AA seqDB search
MPTLASHWAVYARVSCLRTVFEGGKEGYFCYRIPSLVQLGPDSYIAFAEGRKFSCEDHGW
NDIVAKTSSDGGQTWSALAVVYGESSTKANITIGNPAPVVLHDGTLLLVFCRNNQAMLLL
NSTDGGQTWGGFRDVSAGIVDPTWPFFATGPPGSIQLHTGRILVPADHTSGSTQSMAIYS
DDYGQTWTRGAMIPDGNECQAVELPDGTVMMNMRTSQAHRQVAFSKDGGATWSDPVVTVN
GTVCEGSTIMLPDSTGTLVQSFPNSNDRANVSIQTSTDGLSWGNSIQVYAGSSAYSSLQQ
ANNNTAVALLLEMDSYQKIAFAMVSLV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcccacactggcttcacattgggccgtgtatgcacgagtgtcgtgcttgcgtacggtc
tttgagggtggcaaagaggggtacttttgctaccgtatcccatccctcgtgcaacttggt
cccgactcgtacattgcctttgccgaagggcgcaaattctcgtgtgaagatcatggttgg
aatgacattgtggccaaaaccagcagcgatggagggcaaacgtggtcagcgctggccgtg
gtgtacggtgaatcctcgaccaaggcgaacatcaccataggcaaccccgcgcccgttgtg
ctccatgatgggacccttttgctcgttttctgccgcaacaaccaggccatgctgcttctc
aatagcactgatggtggccaaacgtggggcggctttcgtgatgtgagcgccggcatcgtc
gaccccacttggcctttctttgccaccggtccgccgggcagtattcagttgcatactggt
cgaatcttggtgcccgccgatcatacaagcgggtcaactcagtccatggccatttatagc
gacgactatggtcaaacgtggactcgaggtgctatgattcccgacggaaacgaatgccag
gctgtggaactgcccgatggtaccgttatgatgaacatgcgtacctcgcaagctcatcgt
caggtcgcgttttccaaggatggtggcgccacatggagcgatcccgttgtgacggtcaac
ggaacggtttgcgaaggctcgacgatcatgctgcccgactcgacaggcactcttgtccag
tcctttcccaattccaacgatcgtgccaatgtcagcattcagacttcgacggacggcctg
tcatggggcaactcaattcaggtgtacgctggatcaagcgcctactcctcactgcagcag
gcgaacaataacacggctgtagctctgctgttggagatggatagctaccaaaaaattgcc
tttgccatggtctcactcgtttga

DBGET integrated database retrieval system