KEGG   Monosiga brevicollis: MONBRDRAFT_32442Help
Entry
MONBRDRAFT_32442  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C GST_C_6
Motif
Other DBs
NCBI-GeneID: 5891191
NCBI-ProteinID: XP_001745953
JGI: 32442
UniProt: A9UZI9
LinkDB All DBs
AA seq 372 aa AA seqDB search
MFTGRRGEGDTAARHNKSTQQQSAPPMEYDQNARAPHHNGGTGRKTFKQGTLPPVEDQVT
DALSVTDPLTHWLTDPGCRYLHTQSDDQKSVVNNSYANQQQQLLSQVQHKTSIKCNNFIY
LYKCFNNINTESRGNPFSEPSLSLENGKNPYKPEKMEKTVEVETASSGQSDGIKLYWCPK
TRAVRMAWMLEELGQPYERIKIDIRDETSQSRNDRAFREASPMGKVPALRHGPIKLWDSG
AMCLYLADAFPEAGLAVAPSDPRRGQYLQWTLFTNSVLEPAMTERIAGMEPHPSSHGHGS
FDQMITTLEQALQQGPWLLGEQFTSADVLVGTGISFMIQFGVLKEPSTVLTDYVARCSAR
PACQRAHAFESE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaggcaggcgaggcgagggggacacggcagcacgacacaacaagtcaacacaa
caacaaagcgctccaccaatggagtacgatcaaaatgcacgagcaccccatcacaacggc
ggcacggggcgaaagacgttcaagcaggggacgttgcccccagtcgaggaccaggtcacc
gacgccctctcagtcactgacccactgactcactggctcactgaccccggatgccgttac
ttacacacacagtcagacgatcagaaaagcgttgtgaacaacagttacgcgaatcagcag
cagcaattactaagccaagtgcaacataaaaccagcatcaagtgcaacaactttatctac
ctctacaaatgctttaacaacattaacacagaaagccgaggcaatcccttttccgaaccc
agcctctccctcgaaaatggcaagaatccatacaaaccggaaaaaatggaaaagacggtc
gaggtcgagactgcctccagtggccaatcagatggcatcaagctgtactggtgcccaaag
acgcgcgccgtgcgcatggcctggatgctggaggagctgggccagccgtatgagcgcatt
aagattgacatccgcgacgagaccagtcagagccgcaacgaccgagcctttcgggaggcc
tcacccatgggcaaggtgccggcgctgcggcacggtcccatcaagctgtgggactcgggt
gccatgtgcttgtatctggcagacgcctttcccgaggccggcttggccgtggctccctcc
gatccgcgccgtggccagtatttgcagtggaccttgttcaccaattccgtgctcgagccc
gccatgacggagcggatcgcgggcatggagccacacccttcgagccacggtcacggcagc
tttgatcaaatgatcaccacccttgagcaggctttgcagcagggtccttggctcttgggt
gagcagttcacatctgccgatgtcctggtcggcacgggcatctcctttatgatccaattt
ggcgttctcaaggagccttccactgttctgaccgactatgtggcgcgttgttcagcccgc
cctgcctgccaacgtgcccatgcctttgagtcggagtga

DBGET integrated database retrieval system