KEGG   Monosiga brevicollis: MONBRDRAFT_33571Help
Entry
MONBRDRAFT_33571  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00020  Citrate cycle (TCA cycle)
mbr00190  Oxidative phosphorylation
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01130  Biosynthesis of antibiotics
mbr01200  Carbon metabolism
Module
mbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MONBRDRAFT_33571
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MONBRDRAFT_33571
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MONBRDRAFT_33571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 5893398
NCBI-ProteinID: XP_001748251
JGI: 33571
UniProt: A9V659
LinkDB All DBs
AA seq 646 aa AA seqDB search
MFTRVVKSTAARSASRQLHTSLRRARATEQVSSAYPIVDHEFDAVVVGAGGAGLRAAFGL
TEKGFKTACITKLFPTRSHTVAAQGGINAALGNMENDDWRWHFYDTVKGSDWLGDQDAIH
YMSKEAPNTVIELENYGMPFSRTEDGRIYQRAFGAQSLDYGRGGQAHRCCAVADRTGHSL
LHTLYGQSLRYDTAYFIEYFALDLIMNDEGECVGVLAMCQEDGTLHRFHCKNTVLATGGF
GRCYFSATSAHACTGDGNAMVARAGLHNSDLEFVQFHPTGIYGAGCLITEGCRGEGGILL
NSEGERYMERYAPTAKDLASRDVVSRSSTIEIREGRGCGPDKDHVYLQLSHLPAEVLQER
LPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGVPTNWRGQVITNKNGQEQVVPGLYAAG
EVACASVHGANRLGANSLLDIVVFGRACANTISEINKPGEKLSPLPANAGEASIARLDAT
RFADGRSSVADLRLQMQKTMQTHAAVFRDGPTLKEGVQKMEDLYSVVQSDMKLFDRGLVF
NTDLIEALELQNLMLCATQTIVSAEARKESRGAHAREDFPNREDEFDYSKPLEGQKERSF
EQHWRKHTLSTIDEKTGAVNLSYRPVIDHTLDKEEVTTVPPVIRKY
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacgcgtggtcaagtccacggcggcacgcagcgccagccgccagctgcatacc
agccttcgtcgcgctcgcgctacggaacaggtgtcctcggcctaccccattgtggaccat
gagtttgatgccgttgtcgttggtgccggtggcgcgggtctccgtgccgcctttggcctg
acggagaagggcttcaagacggcttgcatcaccaagctcttccccactcgttcccacacg
gtggctgcccagggcggcatcaacgccgcgcttggtaacatggagaatgacgattggcgt
tggcatttttacgacacggtcaagggttccgactggctcggtgatcaggacgccattcac
tacatgtccaaggaggcgcccaacaccgtcattgagctcgagaactatggcatgcccttc
tcccgtaccgaggacggtcgtatctaccaacgcgccttcggtgctcagtcattggactat
ggccgtggcggccaggcccatcgttgctgcgccgttgctgaccgtaccggccacagtctt
ttgcacaccctctatggccagagcctgcgctatgacaccgcctactttatcgagtacttc
gccctggacctcatcatgaatgacgagggcgagtgcgtcggtgtccttgccatgtgccag
gaggacggtaccctccatcgcttccactgcaagaacacggttctggccaccggtggcttt
ggccgctgctacttctccgccacctcggcgcatgcctgcactggtgacggtaatgccatg
gtcgcccgcgctggtctccacaactcggacctggagtttgttcagttccaccccactggc
atctacggtgccggctgcctcatcaccgagggttgccgtggcgaaggtggtatccttctc
aactccgagggcgagcgctacatggagcgctacgcccccaccgccaaggatctggcctcg
cgtgatgtcgtctctcgttcctccaccattgagattcgtgaaggccgtggctgcggcccc
gacaaggaccacgtttacctgcagctctcgcacctccccgccgaggtccttcaagagcgt
ttgcccggcatcagcgagacagccgccatttttgccggcgttgacgttaccaaggaaccc
atccccgtcctgcccaccgtccactacaacatgggtggcgtgcccaccaactggcgtggt
caagtcatcacgaacaagaatggccaggagcaagttgtccccggtctctacgctgccggc
gaggtcgcctgcgcctcagttcatggcgccaaccgcctcggtgccaactctctgctggat
atcgtcgtctttggccgtgcctgcgccaacaccatctccgagattaacaagcccggcgag
aagctgagccctcttcctgccaacgccggtgaagcctccatcgctcgtctcgatgccacg
cgctttgctgacggtcgctcttcagttgccgatctccgtctccaaatgcaaaagaccatg
caaacccatgccgccgtgttccgtgatggccccaccctcaaggagggcgttcagaagatg
gaggacctgtactctgtcgtgcagagcgacatgaagctcttcgaccgtggccttgttttc
aacaccgaccttatcgaggctcttgagctgcagaatctgatgctttgcgccacgcaaacc
attgtctcagcagaggctcgcaaggagagccgtggtgctcacgctcgcgaggacttcccc
aaccgtgaggacgagtttgactacagcaagcccctggaaggtcaaaaggagcgttctttt
gagcaacactggcgcaagcacaccctgtcgaccattgacgaaaagacgggcgccgtcaac
ctctcgtaccgccccgtcattgaccacactctcgacaaggaggaggtcaccacggtaccc
ccggttatccgcaagtactaa

DBGET integrated database retrieval system