KEGG   Monosiga brevicollis: MONBRDRAFT_38487Help
Entry
MONBRDRAFT_38487  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 5894238
NCBI-ProteinID: XP_001748947
JGI: 38487
UniProt: A9V854
LinkDB All DBs
AA seq 508 aa AA seqDB search
MPIVQRTVEPVHLCREPLPPRCKNELQQVAVNALAGILRQLGDVARHAEEIFGDLVDIAS
NIAERTADVENRLTVARQSVATIQVPTKFDVAELMSGESYQRSHPFDQRLISTMAKPGSL
VDKYRTCDPPPDLNKLNPYRDDNLYTDPGFFLRLWVEQMRLETEEQKKKRKRRKKKQARS
QQTTSRRQVARVAKKEYSAMGSEFNDDQRALKQQQIQQEQQQLRQQQLERQAQSQGQDMG
PPPTNAPAPAKPAGAPPPPPQKPAGAPPPPPSKPGAAPPPPPGGNIPPPPPTDAPANIPP
PPPMGATPPPPPPPGAGGAPPPPPPNTAKPVLVLEGMEDDDATETDMPAPVMPPPMSAPA
PPPPPGSGAPAPPPAPPMGAPPTGAPPPPGPAPPPMANIPAPPGAPPPPSMAPSGAPPPP
GPPAPPPAPESLAKAVGGAGGHGNALLDAIMNKRLNKVDHQEVQKARHASAGGSDVAAIL
ARRIAVYGSDSEDDGSDDEDWSDDEEWD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgtccagcgtaccgttgaaccggtccacctgtgccgtgagcccttgccgcca
cgatgcaagaacgagcttcagcaggttgccgtcaatgcgttagcgggcattctgcgtcaa
ttgggtgatgtggctcgccacgccgaggaaatctttggcgatctagttgatattgcatcc
aacattgccgagcggactgcggatgttgagaatcggctcaccgtcgctcgccagtccgtt
gcgaccatccaggtgcccaccaagtttgacgtggccgagctgatgtcgggcgaatcttac
cagcgcagccatccctttgatcagcgcctcatctccaccatggccaaaccaggctcactc
gttgacaagtatcgcacttgtgatccacccccagacctcaacaaactcaacccctatcgc
gatgacaacctgtacacggatccaggcttcttcctgcgattgtgggtggagcagatgcgt
cttgaaaccgaagagcaaaagaagaagcgcaagcgccgtaagaaaaaacaggctcgctct
cagcagaccacatcgcgccgccaagttgctcgcgtggccaagaaggagtactcagccatg
ggttcagaattcaacgatgaccagcgcgccctcaagcaacaacaaattcaacaggagcaa
caacagctccgccagcagcaactggagcgtcaagcccagagtcagggccaggacatgggc
cctccccctaccaacgcgcctgcacccgccaaacccgccggcgcgccaccgccgccgccg
caaaagcccgccggcgcaccacccccacccccctccaaaccgggtgcagcaccacctccg
ccaccgggtggcaacatccccccgccgcctccgaccgacgccccggccaacatccctcct
cctccacccatgggtgcaacgccgccaccgccgccacctcctggcgcgggtggtgcaccg
ccgccgccgcctcccaacaccgccaagcccgtcttggtcctcgagggcatggaggatgat
gacgctacggaaacagacatgccggctcccgtgatgccacctcccatgagcgctccggcg
cccccgccaccaccaggttcaggtgcccctgcaccacccccggcccctcccatgggcgcc
ccacctacgggtgcccctcccccacctggcccggctccgccacccatggccaacatccca
gcaccacctggtgcacccccgccgccaagcatggccccctcgggtgcacccccaccccca
ggaccccccgcccccccgcctgcccctgaaagtctggccaaggcagtgggtggtgctggt
ggccacggcaatgcccttttggatgccattatgaacaagcgtctcaacaaggtcgatcat
caggaagtccaaaaagctcgccatgccagtgcaggtggctcggatgttgccgccatcctg
gctcgtcgtattgccgtgtacggctctgactcggaagatgatggctcggatgatgaggat
tggtccgacgacgaggagtgggactaa

DBGET integrated database retrieval system