KEGG   Monosiga brevicollis: MONBRDRAFT_38555Help
Entry
MONBRDRAFT_38555  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00562  Inositol phosphate metabolism
mbr01100  Metabolic pathways
mbr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MONBRDRAFT_38555
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MONBRDRAFT_38555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mbr01009]
    MONBRDRAFT_38555
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MONBRDRAFT_38555
    3.1.3.48  protein-tyrosine-phosphatase
     MONBRDRAFT_38555
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     MONBRDRAFT_38555
Protein phosphatases and associated proteins [BR:mbr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    MONBRDRAFT_38555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 5894364
NCBI-ProteinID: XP_001749050
JGI: 38555
UniProt: A9V8Q5
LinkDB All DBs
AA seq 422 aa AA seqDB search
MATIAKHLVSKKKRRFMDEGFDLDLTFITRNIVAMGFPAEGREGIYRNHMRDVKRFFDYR
CKDHYRVYNLCSERDYDPQKFYGRVAKYPFDDHNAPPFLLMQPFCEDVHQYLSEDSRNVA
VIHCKAGKGRTGVMISAYLMHCGLFEKTEEALEFYGHARTMNGKGVTIPSQVRYVHYYGR
YVREQREFEPIPLIMKRIILHGIPDFKDGTCVPQFTLRHGPQHVLTFKSGWYEGISREQG
TATLELKPHTPVCGDVKLEFIHRKGSSGKEKMFHLWFNTFFIVNNRFYAAQSEVDKANKD
KKNKIYPEGFAIEILFDNPEGNAKTSSPLAANSLSASTASAQGMVPTASDGSDPAIPATS
RGGQPMLPSRGPDASGEPLSAIPGKLTHRDSNVSQAPEFSDSDLTTTDEDDDEWEGLPIS
DV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccattgccaagcatttggtctccaaaaagaagcgccgcttcatggatgagggc
tttgacctcgacctcaccttcatcacccgcaacattgtcgccatgggctttcctgccgag
ggccgggaaggcatttaccgcaaccacatgcgcgacgtcaagcgcttcttcgactatcgc
tgcaaggatcactaccgcgtttacaacctgtgttccgagcgcgattatgacccgcaaaag
ttttacggccgcgttgcaaagtatcctttcgatgaccacaacgcaccccccttccttctg
atgcagcccttttgtgaagacgtacaccagtacctcagcgaagattctcgcaacgtcgcc
gtcattcactgcaaagctggcaagggccgaaccggcgtcatgatctccgcctacctgatg
cactgcggcctgtttgagaaaaccgaggaagccctcgagttttacggccatgcccgcacc
atgaacggcaagggcgtcaccattcccagccaagtgcgctacgttcactactacggccgc
tacgttcgtgaacagcgcgagtttgaacccatcccactcatcatgaagcgcatcatcctc
cacggcatccccgactttaaggacggcacttgcgtgccccaattcactcttcgtcatggg
ccgcaacacgtcctcaccttcaagagcggctggtacgagggcatctctcgcgagcaaggc
accgccacgctggagctgaagccccacaccccggtctgcggcgacgtcaaactcgagttt
atccaccgcaagggcagctctggcaaggaaaaaatgtttcacctctggtttaacaccttt
tttatcgtcaacaaccgcttttatgcggcccagtccgaggtcgacaaggccaacaaggac
aagaaaaacaaaatttaccccgaaggctttgccattgagatcctctttgacaatcccgaa
ggcaacgccaaaacctcctccccgctcgctgccaacagcctctctgcatcaaccgcgtcc
gcccaaggcatggttcccacggcatcagacggctcagatcccgccatacctgccacttcc
cgtggtggccagcccatgctcccctctcgcgggcccgatgcttctggagaacccctgagt
gccattcccggaaaactcacccaccgcgactccaacgtctcccaggctcccgaattttcc
gattcggacctcacaaccaccgacgaggatgacgatgaatgggagggccttcccatcagc
gatgtatag

DBGET integrated database retrieval system