KEGG   Methylocystis bryophila: B1812_02725Help
Entry
B1812_02725       CDS       T04837                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00030  Pentose phosphate pathway
mbry00710  Carbon fixation in photosynthetic organisms
mbry01100  Metabolic pathways
mbry01110  Biosynthesis of secondary metabolites
mbry01120  Microbial metabolism in diverse environments
mbry01130  Biosynthesis of antibiotics
mbry01200  Carbon metabolism
mbry01230  Biosynthesis of amino acids
Module
mbry_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B1812_02725
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    B1812_02725
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    B1812_02725
Enzymes [BR:mbry01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     B1812_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh Wound_ind TetR_C_15
Motif
Other DBs
NCBI-ProteinID: ARN80178
UniProt: A0A1W6MRF4
LinkDB All DBs
Position
610639..612636
Genome map
AA seq 665 aa AA seqDB search
MKEVSMLDVPASCTREDANAIRALAMDAVDRAKSGHPGMPMGMADVASVLFRSFLKFDAA
DPHWPNRDRFVLSAGHGSMLLYALGYLVGYPGLEIEDLKNFRQLGSKTAGHPEYGHAPGV
ETTTGPLGQGLATAVGMAIGERLANARFGDAIVDHFTYVIAGDGCLMEGISHEAIDLAGH
LRLGKLVLLWDDNHISIDGPTSLATSTDQALRFEASGWHVQKIDGHDFSQIAAALRAAKE
DPRPSMIACRTVIGYGAPNKQGKESVHGSPLGAEENALARKALGWEHPPFEMPQSILAGW
RLAGSRGAPVRAAWIETLAASGKSQEFARFLEADVAEAIAAPLKALRETAAQEKPKLATR
KSSENALGVINAATTATIGGSADLTHSVFTLTKGLGVVAPENFSGRYIHYGVREFEMAAA
MNGLALYGGFIPYGGTFLVFSDYARGAIRLSALMGLRVIYVLTHDSIGLGEDGPTHQPVE
HLASLRAMPNLNVFRPADAIETAECWELALNARSTPSVLSLSRQNLPTLERPVSENLSAR
GGYVLQEAEGARDVTLIATGSEVSMALEAAKLLAAKGKRAAVVSMPSFELFAAQDAAYRA
LVLGTAPRVGVEAAVRFGWDRWLGERSAFIGMTGFGASAPADALYAHFGITPEAVAKAAL
GVIGK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagtttccatgctcgatgtgcccgcctcttgcacgagggaggacgccaatgcg
atccgcgctctcgccatggacgccgtggacagggccaaatccggccatcccggcatgccc
atgggcatggccgacgtcgccagcgtgctgtttcgctccttcctgaaattcgacgccgcc
gatccgcattggcccaaccgcgaccgcttcgtgctttcggccggccatggctcgatgctg
ctctatgcgctcggctatctcgtcggctatccgggcctcgagatcgaggacttgaagaac
ttccgccagctcggctccaagacggcgggacatccggagtatgggcacgcgcccggcgtc
gagacgacgaccggcccgctgggccaaggtctcgccaccgccgtcggcatggccatcggc
gagcgtctcgccaacgcccgcttcggcgacgcgatcgtcgatcacttcacttatgtcatc
gccggcgacggctgcctgatggaagggatcagccacgaggcgatcgatctcgcaggccat
ctgcggctcggcaagctcgtcttgctctgggacgacaatcacatctccatcgacggaccc
acgagtcttgcgacctcgaccgatcaagccttgcggttcgaggcgagcggctggcatgtg
cagaagatcgacggtcacgatttttcgcagatcgccgcggcgctcagggccgcgaaagag
gacccgcgtccctcgatgatcgcctgccgcacggtcatcggctatggcgcgcccaacaag
cagggcaaggagagcgtccacggctcgcctttaggcgcggaggagaacgccctcgcgcgc
aaggcgctcggctgggagcatccgcccttcgaaatgccccaatccattctcgcgggctgg
cgtctcgctggctcccgcggcgcgccggtgcgggccgcttggatcgagactctcgcggcc
tccggcaagagccaagagttcgcgcgcttccttgaggccgacgtcgcagaggccatcgcc
gcgccgctgaaagcgctgcgcgagaccgccgcgcaagagaagccgaagctcgcgacgcgc
aaatcctccgagaatgcgctgggcgtcatcaacgccgcaacaacggctacgatcggcggc
tcggccgatctcacgcattccgtgttcacgctgacgaaggggctcggcgtcgtcgcgccg
gaaaatttctcaggccgctacatccattacggcgtgcgcgagttcgagatggccgcggcg
atgaacggcctcgcgctttatggcggcttcattccatacggcggcaccttcctcgtcttc
tcggattatgcgcgcggcgcgatcaggctttcggcgctgatggggctgcgcgtcatctat
gtgctgacgcatgattccatcggcctcggcgaggacgggccgacgcaccagcccgtcgag
catctcgcaagcctgcgcgccatgcccaatctcaacgtgttccgcccggccgatgcgatc
gagacggcggagtgctgggagctcgcgctcaacgcgagatcgacgccttccgtgctgagc
ctttcgcgccagaacctgccgaccctcgagcggcccgtttccgagaacctttccgcacgc
ggaggctatgtgctgcaggaagccgagggcgcacgcgatgtgacgctcatcgcgacgggc
tcggaagtttcaatggcgcttgaagccgcaaagcttctcgccgctaaaggcaagcgtgcg
gcggtcgtctccatgccgagcttcgagcttttcgcagcccaggacgccgcctatcgcgcc
ctggtgcttgggactgcgccgcgcgtcggcgtcgaggctgccgttcgcttcggctgggac
cgctggctcggcgagcgctccgccttcatcggcatgacaggcttcggcgcgagcgctccc
gccgacgcgctctatgcgcatttcgggatcacgcccgaagcggtggcgaaagcggcgctg
ggggtgatcggaaagtaa

DBGET integrated database retrieval system