KEGG   Methylocystis bryophila: B1812_06235Help
Entry
B1812_06235       CDS       T04837                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00061  Fatty acid biosynthesis
mbry00780  Biotin metabolism
mbry01100  Metabolic pathways
mbry01130  Biosynthesis of antibiotics
mbry01212  Fatty acid metabolism
Module
mbry_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1812_06235
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B1812_06235
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    B1812_06235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mbry01004]
    B1812_06235
Enzymes [BR:mbry01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     B1812_06235
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     B1812_06235
Lipid biosynthesis proteins [BR:mbry01004]
 Fatty acid synthase
  Component type
   B1812_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ARN80736
UniProt: A0A1W6MT86
LinkDB All DBs
Position
complement(1326268..1327128)
Genome map
AA seq 286 aa AA seqDB search
MTQADSPRLAHSGVLAGKKGLILGIANNRSIAYGIAKACREAGAELALTYQAEVLEKRVR
PLAAELGAHVVGRCDVAETETIDAVFAEVERLWGKLDFLVHCLAYSDRDQLNGRYVDTTA
DNFTQSLLISCYSFTALAQRAEKLMTDGGSMLTLTYYGAEKWMPHYNVMGVAKAALEASV
RYLAADLGEKNIRVNAISAGPIKTAAASGIGDFRYILRWNEYNAPMRRVVTIEEVGESAV
YLLSPMSRGVTGEILHVDAGYHVVGMMHPAAAPKMADLLSLLPQDK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccgattcgccccgtctcgcccatagcggcgttctcgcaggaaagaagggg
ctgatcctcggcatcgcgaataatcgctcgatcgcctatggtatcgccaaggcctgccgc
gaggcgggcgccgagctggccctgacctatcaggcggaagtgctggagaagcgcgtgcgg
ccgcttgccgccgagcttggcgcgcatgtcgtcggccgttgcgacgtcgccgagaccgag
acgatcgacgccgtctttgccgaagtcgaacgactctggggcaagctcgatttcctcgtt
cattgcctcgcctattccgaccgcgaccagcttaacggccgatatgtcgacacgacggcg
gacaacttcactcagtcgctgctgatctcctgctattccttcaccgcgctggcgcagcgc
gccgagaagctgatgacggacggcggctcaatgctgacgctcacctattacggcgccgag
aaatggatgccgcattacaatgtgatgggcgtagccaaggccgcgctcgaggcgtccgtg
cgttatctcgccgccgacctcggcgagaagaacatccgcgtcaacgcgatctccgcggga
ccgatcaagaccgcggcggcttcggggatcggcgacttccgctacattctgcggtggaac
gagtataacgcgccgatgcgccgcgtcgtcacgatcgaggaggttggcgagagcgcggtc
tatctgctttcgccgatgtcgcggggcgtcacgggggagatcctccatgtcgacgccggc
tatcacgtcgtcggcatgatgcaccccgccgcggcgcccaagatggcggatcttttgtcg
ctcttgccgcaagataagtaa

DBGET integrated database retrieval system